Recombinant Full Length E3 Ubiquitin-Protein Ligase Hrd-1(Sel-11) Protein, His-Tagged
Cat.No. : | RFL20820CF |
Product Overview : | Recombinant Full Length E3 ubiquitin-protein ligase hrd-1(sel-11) Protein (A8Y4B2) (24-622aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis briggsae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (24-622) |
Form : | Lyophilized powder |
AA Sequence : | FVINKQFYPSIVYLSKSNASMAVLYFQGIVLVYLMFQLLKSILFGDLRAAEAEHLSERTW HAVLETCLAFTVFRDDFSAMFVMQFIGLLFIKCFHWLADDRVDMMERSPVITLRFHLRMM TVLAALGFADSYFVSSAYFSTITKGASSQIVFGFEYAILLALVLHVTIKYLLHMHDLRNP QSWDNKAVYLLYAELLINLIRCVLYGFFAVIMLRVHTFPLFSVRPFYQSVRALHKAFLDV ILSRRAINAMNSQFPVVSNDELSAMDATCIICREEMTVESSPKRLPCSHVFHAHCLRSWF QRQQTCPTCRTDIWQGRNGAAGGANAGGAAENNAAGAPPAAGIPPFLPFLGHQFGFPQAA AGAQVGGAQAGGHPGPFPHQIFYAPAPANRPEFMNLAPPPMPMAGPPGMFPMMPPPPIPQ PNAAPGESSNAEPPGRPNFDRFSVEELHRMEGDMRDAILARIQAMENIMVILESAQVQMV QLAAITPLRRPVPTAEASEEETATASSVPTSVPSEEPSPAPSTPETASAPRSMFRGNLFN DTQSTSTPSTSAGPQPSLTPSTSSVPSTSSVRTPEADEVRQRRLAHLNARFPPPNPEHE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sel-11 |
Synonyms | sel-11; hrd-1; CBG23271; E3 ubiquitin-protein ligase hrd-1; RING-type E3 ubiquitin transferase hrd-1; Suppressor/enhancer of lin-12 |
UniProt ID | A8Y4B2 |
◆ Recombinant Proteins | ||
OXT-12264M | Recombinant Mouse OXT Protein | +Inquiry |
CDK1-998H | Recombinant Human Cyclin-Dependent Kinase 1, GST-tagged | +Inquiry |
Loxl1-271R | Recombinant Rat Loxl1 Protein, His-tagged | +Inquiry |
SURF1-5843R | Recombinant Rat SURF1 Protein | +Inquiry |
GULP1-7396M | Recombinant Mouse GULP1 Protein | +Inquiry |
◆ Native Proteins | ||
LOC102577615-59P | Native potato LOC102577615 Protein | +Inquiry |
ACPP-29981TH | Native Human ACPP | +Inquiry |
GGT1-8131H | Native Human Liver Gamma Glutamyl Transpeptidase | +Inquiry |
LDL-333H | Native Human LDL Protein | +Inquiry |
Tf-392R | Native Rat Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCR6-7160HCL | Recombinant Human CXCR6 293 Cell Lysate | +Inquiry |
FIBIN-6220HCL | Recombinant Human FIBIN 293 Cell Lysate | +Inquiry |
Colon-91C | Cynomolgus monkey Colon Membrane Lysate | +Inquiry |
SLC25A45-1759HCL | Recombinant Human SLC25A45 293 Cell Lysate | +Inquiry |
FTCD-6129HCL | Recombinant Human FTCD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sel-11 Products
Required fields are marked with *
My Review for All sel-11 Products
Required fields are marked with *
0
Inquiry Basket