Recombinant Full Length Drosophila Yakuba Adenosine Monophosphate-Protein Transferase Ficd Homolog (Ge13868) Protein, His-Tagged
Cat.No. : | RFL21280DF |
Product Overview : | Recombinant Full Length Drosophila yakuba Adenosine monophosphate-protein transferase FICD homolog (GE13868) Protein (B4P0E1) (1-495aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila yakuba (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-495) |
Form : | Lyophilized powder |
AA Sequence : | MGTEAEQPSPPSPPAQQQEQTNPPLWNAQNQKPARLYRLVLFFIAGSLAAWTIHALSNSN LVWKLRQLHHLPTAHYLQTRDEFAVYSVEELNAFKEIYDKSVSDSVGASYTKDEQTSINE ALVSLRMAQDMYLAGKDDKASRLFEHALALAPRHPEVLLRYGEFLEHSQRNIVLADQYYF QALTISPSNSEALANRQRTADVVQTLDERRLQSLDSKRDALSAIHESNGALRRAKKEAYF QHIYHSVGIEGNTMTLAQTRSILETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKIDI TIKDILELHRRVLGHVDPIEGGEFRRNQVYVGGHVPPGPGDLALLMQRFERWLNSEHSST LHPVNYAALAHYKLVHIHPFIDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRNKYYHFLKL ANEGDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQTESEAGERLAQMQSPNVAQR SSILEFYESGSGALP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GE13868 |
Synonyms | GE13868; Protein adenylyltransferase Fic; De-AMPylase Fic |
UniProt ID | B4P0E1 |
◆ Recombinant Proteins | ||
APOA5-7443H | Recombinant Human APOA5 protein, His-GST&Myc-tagged | +Inquiry |
Ifna13-619M | Active Recombinant Mouse Ifna13 protein(Cys24-Lys189), His-tagged | +Inquiry |
PSMA7-6181C | Recombinant Chicken PSMA7 | +Inquiry |
DTWD1-2715H | Recombinant Human DTWD1 Protein, His-tagged | +Inquiry |
RCOR1-301383H | Recombinant Human RCOR1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
AC-62H | Native Human Activated Protein C | +Inquiry |
Alb-109R | Native Rat Albumin | +Inquiry |
Thrombin-22H | Active Native Human Thrombin Protein | +Inquiry |
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
C1QA-26126TH | Native Human C1QA | +Inquiry |
◆ Cell & Tissue Lysates | ||
NKX2-3814HCL | Recombinant Human NKX2 293 Cell Lysate | +Inquiry |
PWP2-2655HCL | Recombinant Human PWP2 293 Cell Lysate | +Inquiry |
CMC1-7420HCL | Recombinant Human CMC1 293 Cell Lysate | +Inquiry |
PAAF1-3477HCL | Recombinant Human PAAF1 293 Cell Lysate | +Inquiry |
TMEM200A-973HCL | Recombinant Human TMEM200A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GE13868 Products
Required fields are marked with *
My Review for All GE13868 Products
Required fields are marked with *
0
Inquiry Basket