Recombinant Full Length Drosophila Virilis Opsin Rh4(Rh4) Protein, His-Tagged
Cat.No. : | RFL18349DF |
Product Overview : | Recombinant Full Length Drosophila virilis Opsin Rh4(Rh4) Protein (P17646) (1-383aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila virilis (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-383) |
Form : | Lyophilized powder |
AA Sequence : | MDIAGSLCNASEGPVLRPEARVSGNGDLQFLGWNVPPDQIQHIPEHWLTQLEPPASMHYM LGVFYIFLFCASTVGNGMVIWIFSTSKALRTPSNMFVLNLAVFDFIMCLKAPIFIYNSFH RGFALGNTGCQIFAAIGSYSGIGAGMTNAAIGYDRLNVITKPMNRNMTFTKAIIMNVIIW LYCTPWVVLPLTQFWDRFVPEGYLTSCTFDYLTDNFDTRLFVGTIFFFSFVCPTLMIIYY YSQIVGHVFSHEKALREQAKKMNVESLRSNVDKSKDTAEIRIAKAAITICFLFFVSWTPY GVMSLIGAFGDKSLLTPGATMIPACTCKLVACIDPFVYAISHPRYRMELQKRCPWLAIDE KAPESSSAASTTTTQEQQQTTAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rh4 |
Synonyms | Rh4; Opsin Rh4; Inner R7 photoreceptor cells opsin |
UniProt ID | P17646 |
◆ Recombinant Proteins | ||
MLEC-596H | Recombinant Human MLEC Protein, MYC/DDK-tagged | +Inquiry |
ACTL6A-221H | Recombinant Human ACTL6A Protein, GST-tagged | +Inquiry |
PCED1A-12486M | Recombinant Mouse PCED1A Protein | +Inquiry |
RFL32520VF | Recombinant Full Length Vibrio Fischeri Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
CD70-038H | Recombinant Human CD70 Protein, Leu50-Pro193, N-His tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
Collagen Type I & III-05C | Native Canine Collagen Type I and III Protein | +Inquiry |
COL2A1-13B | Native Bovine COL2A1 Protein | +Inquiry |
MMP9-9810 | Active Native Human MMP9 | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAT1-425HCL | Recombinant Human VAT1 293 Cell Lysate | +Inquiry |
ALDH1A2-8920HCL | Recombinant Human ALDH1A2 293 Cell Lysate | +Inquiry |
TEKT4-1760HCL | Recombinant Human TEKT4 cell lysate | +Inquiry |
HBG1-5620HCL | Recombinant Human HBG1 293 Cell Lysate | +Inquiry |
ZNF653-2069HCL | Recombinant Human ZNF653 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Rh4 Products
Required fields are marked with *
My Review for All Rh4 Products
Required fields are marked with *
0
Inquiry Basket