Recombinant Full Length Drosophila Pseudoobscura Pseudoobscura Opsin Rh4(Rh4) Protein, His-Tagged
Cat.No. : | RFL403DF |
Product Overview : | Recombinant Full Length Drosophila pseudoobscura pseudoobscura Opsin Rh4(Rh4) Protein (P29404) (1-380aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila pseudoobscura pseudoobscura (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-380) |
Form : | Lyophilized powder |
AA Sequence : | MDALCNASEPPLRPEARMSSGSDELQFLGWNVPPDQIQYIPEHWLTQLEPPASMHYMLGV FYIFLFFASTLGNGMVIWIFSTSKSLRTPSNMFVLNLAVFDLIMCLKAPIFIYNSFHRGF ALGNTWCQIFASIGSYSGIGAGMTNAAIGYDRYNVITKPMNRNMTFTKAVIMNIIIWLYC TPWVVLPLTQFWDRFVPEGYLTSCSFDYLSDNFDTRLFVGTIFFFSFVCPTLMILYYYSQ IVGHVFNHEKALREQAKKMNVESLRSNVDKSKETAEIRIAKAAITICFLFFVSWTPYGVM SLIGAFGDKSLLTPGATMIPACTCKLVACIDPFVYAISHPRYRMELQKRCPWLGVNEKSG EASSAQSTTTQEQTQQTSAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rh4 |
Synonyms | Rh4; GA28288; Opsin Rh4; Inner R7 photoreceptor cells opsin |
UniProt ID | P29404 |
◆ Native Proteins | ||
IgG-150G | Native Goat IgG Fab fragment | +Inquiry |
GPCP-28 | Active Native Glycerophosphocholine phosphodiesterase | +Inquiry |
LRG1-3684H | Native Human LRG1 | +Inquiry |
FLNC-4360C | Native Chicken Filamin C, Gamma | +Inquiry |
CELA3B-25P | Native Porcine Elastase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZKSCAN4-159HCL | Recombinant Human ZKSCAN4 293 Cell Lysate | +Inquiry |
DNAJB6-6883HCL | Recombinant Human DNAJB6 293 Cell Lysate | +Inquiry |
Heart Ventricle-220H | Human Heart Ventricle (LT) Lysate | +Inquiry |
SYCE1-644HCL | Recombinant Human SYCE1 lysate | +Inquiry |
ADSL-8995HCL | Recombinant Human ADSL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rh4 Products
Required fields are marked with *
My Review for All Rh4 Products
Required fields are marked with *
0
Inquiry Basket