Recombinant Full Length Drosophila Pseudoobscura Pseudoobscura Opsin Rh3(Rh3) Protein, His-Tagged
Cat.No. : | RFL36173DF |
Product Overview : | Recombinant Full Length Drosophila pseudoobscura pseudoobscura Opsin Rh3(Rh3) Protein (P28680) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila pseudoobscura pseudoobscura (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MEYHNVSSVLGNVSSVLRPDARLSAESRLLGWNVPPDELRHIPEHWLIYPEPPESMNYLL GTLYIFFTVISMIGNGLVMWVFSAAKSLRTPSNILVINLAFCDFMMMIKTPIFIYNSFHQ GYALGHLGCQIFGVIGSYTGIAAGATNAFIAYDRYNVITRPMEGKMTHGKAIAMIIFIYL YATPWVVACYTESWGRFVPEGYLTSCTFDYLTDNFDTRLFVACIFFFSFVCPTTMITYYY SQIVGHVFSHEKALRDQAKKMNVDSLRSNVDKSKEAAEIRIAKAAITICFLFFASWTPYG VMSLIGAFGDKTLLTPGATMIPACTCKMVACIDPFVYAISHPRYRMELQKRCPWLAISEK APESAAAISTSTTQEQQQTTAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rh3 |
Synonyms | Rh3; GA10619; Opsin Rh3; Inner R7 photoreceptor cells opsin |
UniProt ID | P28680 |
◆ Recombinant Proteins | ||
FOLH1-151H | Recombinant Human FOLH1 Protein, His-tagged | +Inquiry |
COL12A1-16H | Recombinant Human COL11A1 protein, His-tagged | +Inquiry |
Pdcd1lg2-542R | Active Recombinant Rat Pdcd1lg2 protein, His-tagged | +Inquiry |
IGFBP2-824H | Recombinant Human IGFBP2 protein, His & T7-tagged | +Inquiry |
SPRR1A-96H | Recombinant Human SPRR1A protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
AMBP-5312H | Native Human Alpha-1-Microglobulin/Bikunin Precursor | +Inquiry |
Hp-194R | Native Rat Haptoglobin | +Inquiry |
CVB5-13 | Native Coxsackievirus B5 Antigen | +Inquiry |
Lectin-1836R | Native Ricinus Communis Ricin B Chain Protein | +Inquiry |
Laminin-32H | Native Human Laminin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHA4-1446RCL | Recombinant Rat EPHA4 cell lysate | +Inquiry |
ACKR4-171HCL | Recombinant Human ACKR4 lysate | +Inquiry |
DTNA-6799HCL | Recombinant Human DTNA 293 Cell Lysate | +Inquiry |
SNTG1-1607HCL | Recombinant Human SNTG1 293 Cell Lysate | +Inquiry |
ZFAND6-184HCL | Recombinant Human ZFAND6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rh3 Products
Required fields are marked with *
My Review for All Rh3 Products
Required fields are marked with *
0
Inquiry Basket