Recombinant Full Length Drosophila Pseudoobscura Pseudoobscura Adenosine Monophosphate-Protein Transferase Ficd Homolog(Ga21854) Protein, His-Tagged
Cat.No. : | RFL36762DF |
Product Overview : | Recombinant Full Length Drosophila pseudoobscura pseudoobscura Adenosine monophosphate-protein transferase FICD homolog(GA21854) Protein (Q29JP8) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila pseudoobscura pseudoobscura (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MAMTILHASEKVNAEAEATTCPPTEKVKEEQQQQEQLQHSKTSKRVQFYRFALFFIAGSF AAFSFHALTSSSSWRLRQLHHLPNAHYLQTREEFAVYSVEELNAFKEFYDKSISDSVGAS YSEAEQTNIKEALGALRLAQDMHLSGKDDKASRLFEHALALAPKHPEVLLRYGEFLEHNQ RNIVLADQYYFQALTLCPSNSEALANRQRTAEVVQTLDERRLQSLDSKRDALSAIHESSS ALRRAKKEAYFQHIYHSVGIEGNTMTLAQTRSILETRMAVDGKSIDEHNEILGMDLAMKY INASLVQKLEITIKDILELHRRVLGHVDPIEGGEFRRNQVYVGGHVPPGPGDLALLMQRF ERWLNSEHSSSLHPVNYAAYAHYKLVHIHPFIDGNGRTSRLLMNTLLMRAGYPPVIIPKQ QRSKYYHFLKLANEGDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQTESEAGEQL AQMRSPHISAQSASIPEFYEFSGSGFQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GA21854 |
Synonyms | GA21854; Protein adenylyltransferase Fic; De-AMPylase Fic |
UniProt ID | Q29JP8 |
◆ Recombinant Proteins | ||
IL26-1674H | Recombinant Human IL26 Protein, His&GST-tagged | +Inquiry |
RFL21539SF | Recombinant Full Length Shewanella Woodyi Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged | +Inquiry |
WNT3A-10H | Recombinant Human WNT3A Protein, His/S-tagged | +Inquiry |
IL1RN-255R | Recombinant Rhesus monkey IL1RN Protein, His-tagged | +Inquiry |
PAQR3-3300R | Recombinant Rhesus monkey PAQR3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CA 19-9-135 | Active Native Human CA 19-9 protein | +Inquiry |
APOA2-8036H | Native Human ApoLipoprotein APOA2 | +Inquiry |
Immunoglobulin D-79H | Native Human Immunoglobulin D | +Inquiry |
Alb-7992M | Native Mouse Serum Albumin | +Inquiry |
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RIC3-2341HCL | Recombinant Human RIC3 293 Cell Lysate | +Inquiry |
MFGE8-422HCL | Recombinant Human MFGE8 cell lysate | +Inquiry |
FGD6-621HCL | Recombinant Human FGD6 cell lysate | +Inquiry |
VTCN1-1096HCL | Recombinant Human VTCN1 cell lysate | +Inquiry |
SmallIntestine-497C | Chicken Small Intestine Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GA21854 Products
Required fields are marked with *
My Review for All GA21854 Products
Required fields are marked with *
0
Inquiry Basket