Recombinant Full Length Drosophila Persimilis Adenosine Monophosphate-Protein Transferase Ficd Homolog (Gl25530) Protein, His-Tagged
Cat.No. : | RFL18549DF |
Product Overview : | Recombinant Full Length Drosophila persimilis Adenosine monophosphate-protein transferase FICD homolog (GL25530) Protein (B4GJC1) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila persimilis (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MAMTILHASEKVNAEAEATTCPPTEKVKEEQQQQEQLQHSKTSKRVQFYRFALFFIAGSF AAFSFHALTSSSSWRLRQLHHLPNAHYLQTREEFAVYSVEELNAFKEFYDKSISDSVGAS YSEAEQTNIKEALGALRLAQDMHLSGKDDKASRLFEHALALAPKHPEVLLRYGEFLEHNQ RNIVLADQYYFQALTLCPSNSEALANRQRTAEVVQTLDERRLQSLDSKRDALSAIHESSS ALRRAKKEAYFQHIYHSVGIEGNTMTLAQTRSILETRMAVDGKSIDEHNEILGMDLAMKY INASLVQKLEITIKDILELHRRVLGHVDPIEGGEFRRNQVYVGGHVPPGPGDLALLMQRF ERWLNSEHSSSLHPVNYAAYAHYKLVHIHPFIDGNGRTSRLLMNTLLMRAGYPPVIIPKQ QRSKYYHFLKLANEGDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQTESEAGEQL AQMRSPHISAQSASIPEFYEFSGSGFQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GL25530 |
Synonyms | GL25530; Protein adenylyltransferase Fic; De-AMPylase Fic |
UniProt ID | B4GJC1 |
◆ Recombinant Proteins | ||
ABCB6A-7375Z | Recombinant Zebrafish ABCB6A | +Inquiry |
ASGR1-1382M | Recombinant Mouse ASGR1 protein, His-tagged | +Inquiry |
ACP6-3722H | Recombinant Human ACP6 protein, His-tagged | +Inquiry |
AP2M1-3533C | Recombinant Chicken AP2M1 | +Inquiry |
CPTP-4988H | Recombinant Human CPTP Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
OXT-5360H | Native Human Oxytocin, Prepropeptide | +Inquiry |
Ighg2a-161M | Native Mouse Immunoglobulin G2a | +Inquiry |
COL2A1-13B | Native Bovine COL2A1 Protein | +Inquiry |
IgG-123G | Native Guinea pig Immunoglobulin G | +Inquiry |
FGB-31B | Native Bovine Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNK1-1933HCL | Recombinant Human WNK1 cell lysate | +Inquiry |
MAP4K3-4501HCL | Recombinant Human MAP4K3 293 Cell Lysate | +Inquiry |
SMARCC2-1669HCL | Recombinant Human SMARCC2 293 Cell Lysate | +Inquiry |
HLA-DQA2-5494HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
ZFYVE28-1981HCL | Recombinant Human ZFYVE28 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GL25530 Products
Required fields are marked with *
My Review for All GL25530 Products
Required fields are marked with *
0
Inquiry Basket