Recombinant Full Length Drosophila Melanogaster Sodium/Potassium-Transporting Atpase Subunit Beta-1-Interacting Protein(Nkain) Protein, His-Tagged
Cat.No. : | RFL24283DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Sodium/potassium-transporting ATPase subunit beta-1-interacting protein(NKAIN) Protein (A6MHQ4) (1-658aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-658) |
Form : | Lyophilized powder |
AA Sequence : | MGSCSCTRRHFLLSICFLQVITIIERQVFDFLGYMWAPILVNFFHILFIIFGFYGAYHFR VKYIITYLIWNFLWIGWNTFLICFYLNVGQLNRDSDLLNLGTGSVSWFEANGYGCKPTYN MAADDTFRPQRPERVEGCLLDYPLVEITHSGVQCALALLGILGAILISCIFLDEDDRFDF MNGDAKSPQHTVVHPMYVSYTSIPTTSASATMQSNKHLQLQHQQPQQNSLKLYHHQQQQQ PKLHHFNKNYQLSGSNNNTLNNNLHQRAPALLPPNTTNNRSASFQTQSHPSNNHVTQRTG GEGSNCSSLRRHRQHHSKALVSPSPMSPQTTPSLSYASLQNSSPYLAGNSLSNSNYSIFQ SPDSLQGSSHFARIHHKPKPPKSDYPVSGEFNPGGNISSPVRPLDRLSRSLEDDEDNFSL QKFAPGEHGVTYVPFQSPTPNSLFLGENNNSQPHLVFHTNSRSSPNNNAYPYDQSGLPSS LRMGSNSNARRPTHIPLPTVPMHNCQEVENDEDADGESEQDHDQMLTPPPPPLVRPHIHQ RLGQAPYLDLSPEVAERYAIPSKLGPSLPIQVPLPVPHGSPMVRRSNRRPRPSNPVNFCD QIRATPPGYVVRAQSDDRLMEQVEADAAPHVNRRSGRGGSGQKTRPRSFCNSIVGVQG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NKAIN |
Synonyms | NKAIN; CG34413; Sodium/potassium-transporting ATPase subunit beta-1-interacting protein; Na(+/K(+-transporting ATPase subunit beta-1-interacting protein; dNKAIN |
UniProt ID | A6MHQ4 |
◆ Recombinant Proteins | ||
SEMA3A-853H | Recombinant Human SEMA3A protein, His-tagged | +Inquiry |
SSRP1-29276TH | Recombinant Human SSRP1, His-tagged | +Inquiry |
MID1IP1-1629H | Recombinant Human MID1IP1 | +Inquiry |
PSMD7-0303H | Recombinant Human PSMD7 Protein (P2-K324), Tag Free | +Inquiry |
EPS8L1-5267M | Recombinant Mouse EPS8L1 Protein | +Inquiry |
◆ Native Proteins | ||
NUC-0003 | Native Human Nucleosome | +Inquiry |
TF-321H | Native Human Transferrin Rhodamine | +Inquiry |
IgA-250M | Native Monkey Immunoglobulin A | +Inquiry |
PLE-172P | Active Native Porcine Esterase | +Inquiry |
Lectin-1756C | Active Native Canavalia ensiformis Concanavalin A Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHFRL1-6945HCL | Recombinant Human DHFRL1 293 Cell Lysate | +Inquiry |
UBE2C-592HCL | Recombinant Human UBE2C 293 Cell Lysate | +Inquiry |
HDHD2-5595HCL | Recombinant Human HDHD2 293 Cell Lysate | +Inquiry |
FABP2-6478HCL | Recombinant Human FABP2 293 Cell Lysate | +Inquiry |
IFNA4-846MCL | Recombinant Mouse IFNA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NKAIN Products
Required fields are marked with *
My Review for All NKAIN Products
Required fields are marked with *
0
Inquiry Basket