Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 9A(Or9A) Protein, His-Tagged
Cat.No. : | RFL14731DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 9a(Or9a) Protein (Q9W2U9) (1-392aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-392) |
Form : | Lyophilized powder |
AA Sequence : | MSDKVKGKKQEEKDQSLRVQILVYRCMGIDLWSPTMANDRPWLTFVTMGPLFLFMVPMFL AAHEYITQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDA REIIEVENQSDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYD LQVVMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAKHRMIHLPAVGGKE ELEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADLFPNPQSLYF IAFVGSLLIALFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQ MKGYFFEASMATFSTIVRSAVSYIMMLRSFNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or9a |
Synonyms | Or9a; CG15302; Odorant receptor 9a |
UniProt ID | Q9W2U9 |
◆ Recombinant Proteins | ||
RNFT2-14357M | Recombinant Mouse RNFT2 Protein | +Inquiry |
VTCN1-429H | Active Recombinant Human VTCN1 Protein, His-tagged, Biotinylated | +Inquiry |
EZH2-998H | Recombinant Human EZH2, His-GST-tagged | +Inquiry |
NTRK1-1505HFL | Recombinant Full Length Human NTRK1 Protein, C-Flag-tagged | +Inquiry |
RFL24092EF | Recombinant Full Length Arginine Abc Transporter Permease Protein Artm(Artm) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1868W | Active Native Wisteria Floribunda Lectin Protein, Agarose bound | +Inquiry |
Apotransferrin-39H | Native Human Apotransferrin | +Inquiry |
Collagen-59C | Native Chicken Collagen Type II | +Inquiry |
F13-53H | Active Native Human Coagulation Factor XIII, Alexa Fluor 700 Conjugated | +Inquiry |
GOx-30A | Active Native Aspergillus Niger Glucose Oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Jejunum-674H | Hamster Jejunum Lysate, Total Protein | +Inquiry |
BBOX1-001HCL | Recombinant Human BBOX1 cell lysate | +Inquiry |
EIF3K-001HCL | Recombinant Human EIF3K cell lysate | +Inquiry |
TRIP6-758HCL | Recombinant Human TRIP6 293 Cell Lysate | +Inquiry |
ARPC4-8684HCL | Recombinant Human ARPC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Or9a Products
Required fields are marked with *
My Review for All Or9a Products
Required fields are marked with *
0
Inquiry Basket