Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 98B(Or98B) Protein, His-Tagged
Cat.No. : | RFL36270DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 98b(Or98b) Protein (Q9VAW0) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-384) |
Form : | Lyophilized powder |
AA Sequence : | MLTDKFLRLQSALFRLLGLELLHEQDVGHRYPWRSICCILSVASFMPLTIAFGLQNVQNV EQLTDSLCSVLVDLLALCKIGLFLWLYKDFKFLIGQFYCVLQTETHTAVAEMIVTRESRR DQFISAMYAYCFITAGLSACLMSPLSMLISYQRTGELQPKFPFPSVYPWDNMKLSNYIIS YFWNVCAALGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHFEGRNTKETHENLKHVFQ LYALCLNLGHFLNEYFRPLICQFVAASLHLCVLCYQLSANILQPALLFYAAFTAAVVGQV SIYCFCGSSIHSECQLFGQAIYESSWPHLLQENLQLVSSLKIAMMRSSLGCPIDGYFFEA NRETLITVSKAFIKVSKKTPQVND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or98b |
Synonyms | Or98b; CG1867; Putative odorant receptor 98b |
UniProt ID | Q9VAW0 |
◆ Recombinant Proteins | ||
MRC2-151H | Recombinant Human MRC2 Protein, His-tagged | +Inquiry |
RPAIN-3778R | Recombinant Rhesus Macaque RPAIN Protein, His (Fc)-Avi-tagged | +Inquiry |
LYZL1-5280M | Recombinant Mouse LYZL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAM4-5214M | Recombinant Mouse-ear cress CAM4 protein, His&Myc-tagged | +Inquiry |
RFL6881MF | Recombinant Full Length Mouse Er Lumen Protein Retaining Receptor 2(Kdelr2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
HB-41D | Native Dog Hemoglobin (HB) Protein | +Inquiry |
MG-202H | Native Human Menopausal Gonadotropin | +Inquiry |
CP-5326H | Native Human Ceruloplasmin (ferroxidase) | +Inquiry |
Collagen-120B | Native Bovine Type I Collagen, FITC-tagged | +Inquiry |
S100A14-394H | Native Human S100A14 protein(Gly2-His104), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H2BM-5535HCL | Recombinant Human HIST1H2BM 293 Cell Lysate | +Inquiry |
SCG2-788HCL | Recombinant Human SCG2 cell lysate | +Inquiry |
Adrenal-8H | Human Adrenal Cytoplasmic Lysate | +Inquiry |
MS4A12-4128HCL | Recombinant Human MS4A12 293 Cell Lysate | +Inquiry |
RPGR-2234HCL | Recombinant Human RPGR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or98b Products
Required fields are marked with *
My Review for All Or98b Products
Required fields are marked with *
0
Inquiry Basket