Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 85F(Or85F) Protein, His-Tagged
Cat.No. : | RFL27605DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 85f(Or85f) Protein (Q9VHE6) (1-392aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-392) |
Form : | Lyophilized powder |
AA Sequence : | MEPVQYSYEDFARLPTTVFWIMGYDMLGVPKTRSRRILYWIYRFLCLASHGVCVGVMVFR MVEAKTIDNVSLIMRYATLVTYIINSDTKFATVLQRSAIQSLNSKLAELYPKTTLDRIYH RVNDHYWTKSFVYLVIIYIGSSIMVVIGPIITSIIAYFTHNVFTYMHCYPYFLYDPEKDP VWIYISIYALEWLHSTQMVISNIGADIWLLYFQVQINLHFRGIIRSLADHKPSVKHDQED RKFIAKIVDKQVHLVSLQNDLNGIFGKSLLLSLLTTAAVICTVAVYTLIQGPTLEGFTYV IFIGTSVMQVYLVCYYGQQVLDLSGEVAHAVYNHDFHDASIAYKRYLLIIIIRAQQPVEL NAMGYLSISLDTFKQLMSVSYRVITMLMQMIQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or85f |
Synonyms | Or85f; CG16755; Odorant receptor 85f |
UniProt ID | Q9VHE6 |
◆ Recombinant Proteins | ||
PYROXD2-3541R | Recombinant Rhesus Macaque PYROXD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCF3-413R | Recombinant Rat ABCF3 Protein | +Inquiry |
RFL14304KF | Recombinant Full Length Koribacter Versatilis Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
DDX1-152H | Recombinant Human DEAD-box helicase 1 Protein, His&Flag&StrepII tagged | +Inquiry |
PARD6A-4271R | Recombinant Rat PARD6A Protein | +Inquiry |
◆ Native Proteins | ||
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
Lectin-1759C | Active Native Canavalia ensiformis Concanavalin A Protein, Fluorescein Labeled | +Inquiry |
HP-190C | Native Dog Haptoglobin | +Inquiry |
GC-196H | Native Human Globulins Cohn fraction IV-4 protein | +Inquiry |
HP-8153H | Native Human Serum Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C6orf120-7999HCL | Recombinant Human C6orf120 293 Cell Lysate | +Inquiry |
LAMP1-1486RCL | Recombinant Rat LAMP1 cell lysate | +Inquiry |
BACE2-1388MCL | Recombinant Mouse BACE2 cell lysate | +Inquiry |
ANXA2R-8010HCL | Recombinant Human C5orf39 293 Cell Lysate | +Inquiry |
SIRT1-595HCL | Recombinant Human SIRT1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or85f Products
Required fields are marked with *
My Review for All Or85f Products
Required fields are marked with *
0
Inquiry Basket