Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 82A(Or82A) Protein, His-Tagged
Cat.No. : | RFL9597DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 82a(Or82a) Protein (P82986) (1-385aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-385) |
Form : | Lyophilized powder |
AA Sequence : | MGRLFQLQEYCLRAMGHKDDMDSTDSTALSLKHISSLIFVISAQYPLISYVAYNRNDMEK VTACLSVVFTNMLTVIKISTFLANRKDFWEMIHRFRKMHEQSASHIPRYREGLDYVAEAN KLASFLGRAYCVSCGLTGLYFMLGPIVKIGVCRWHGTTCDKELPMPMKFPFNDLESPGYE VCFLYTVLVTVVVVAYASAVDGLFISFAINLRAHFQTLQRQIENWEFPSSEPDTQIRLKS IVEYHVLLLSLSRKLRSIYTPTVMGQFVITSLQVGVIIYQLVTNMDSVMDLLLYASFFGS IMLQLFIYCYGGEIIKAESLQVDTAVRLSNWHLASPKTRTSLSLIILQSQKEVLIRAGFF VASLANFVGICRTALSLITLIKSIE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or82a |
Synonyms | Or82a; CG31519; Odorant receptor 82a |
UniProt ID | P82986 |
◆ Recombinant Proteins | ||
Amigo2-8785M | Recombinant Mouse Amigo2 protein, His-tagged | +Inquiry |
Zc2hc1b-7057M | Recombinant Mouse Zc2hc1b Protein, Myc/DDK-tagged | +Inquiry |
ABCF1-12398Z | Recombinant Zebrafish ABCF1 | +Inquiry |
RNASE6-7923H | Recombinant Human RNASE6 protein, His-tagged | +Inquiry |
ACTR8-241H | Recombinant Human ACTR8 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MFGE8-288B | Native Bovine Lactadherin | +Inquiry |
COL3A1-18B | Native Bovine COL3A1 Protein | +Inquiry |
Ferritin-179H | Native Human Ferritin | +Inquiry |
Lectin-1787G | Active Native Griffonia Simplicifolia Lectin II Protein, Agarose bound | +Inquiry |
Collagen-318B | Native Bovine Collagen Type IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGEA8-4550HCL | Recombinant Human MAGEA8 293 Cell Lysate | +Inquiry |
BBOX1-001HCL | Recombinant Human BBOX1 cell lysate | +Inquiry |
FBXL15-272HCL | Recombinant Human FBXL15 lysate | +Inquiry |
MTHFD2-4082HCL | Recombinant Human MTHFD2 293 Cell Lysate | +Inquiry |
PDE1A-3353HCL | Recombinant Human PDE1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or82a Products
Required fields are marked with *
My Review for All Or82a Products
Required fields are marked with *
0
Inquiry Basket