Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 22C(Or22C) Protein, His-Tagged
Cat.No. : | RFL1230DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 22c(Or22c) Protein (P81911) (1-402aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-402) |
Form : | Lyophilized powder |
AA Sequence : | MTDSGQPAIADHFYRIPRISGLIVGLWPQRIRGGGGRPWHAHLLFVFAFAMVVVGAVGEV SYGCVHLDNLVVALEAFCPGTTKAVCVLKLWVFFRSNRRWAELVQRLRAILWESRRQEAQ RMLVGLATTANRLSLLLLSSGTATNAAFTLQPLIMGLYRWIVQLPGQTELPFNIILPSFA VQPGVFPLTYVLLTASGACTVFAFSFVDGFFICSCLYICGAFRLVQQDIRRIFADLHGDS VDVFTEEMNAEVRHRLAQVVERHNAIIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIM LNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLYDMEWYKCDARTRKVIL MILRRSQRAKTIAVPFFTPSLPALRSILSTAGSYITLLKTFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or22c |
Synonyms | Or22c; DOR22C.1; Or22C.1; CG15377; Odorant receptor 22c |
UniProt ID | P81911 |
◆ Native Proteins | ||
F10-63H | Native Human Factor X | +Inquiry |
Prostate-016H | Human Prostate Lysate, Total Protein | +Inquiry |
LYZ-139C | Native Chicken lysozyme | +Inquiry |
Phosphorylase B-49R | Active Native Rabbit Phosphorylase B | +Inquiry |
APOB-8037H | Native Human Plasma APOB | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMG2-2735HCL | Recombinant Human PSMG2 293 Cell Lysate | +Inquiry |
HA-1424HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
Stomach-821H | Hamster Stomach Membrane Lysate, Total Protein | +Inquiry |
MPEG1-4240HCL | Recombinant Human MPEG1 293 Cell Lysate | +Inquiry |
SPC25-1527HCL | Recombinant Human SPC25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or22c Products
Required fields are marked with *
My Review for All Or22c Products
Required fields are marked with *
0
Inquiry Basket