Recombinant Full Length Drosophila Melanogaster Putative Neutral Sphingomyelinase(Cg12034) Protein, His-Tagged
Cat.No. : | RFL6600DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative neutral sphingomyelinase(CG12034) Protein (Q9VZS6) (1-442aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-442) |
Form : | Lyophilized powder |
AA Sequence : | MLLLELNILTLNIWGIPYVSSDRRPRIDAICKELASGKYDIVSLQEVWAQEDSELLQKGT EAVLPHSHYFHSGVMGAGLLVLSKYPILGTLFHAWSVNGYFHRIQHADWFGGKGVGLCRI LVGGQMVHLYNAHLHAEYDNANDEYKTHRVIQAFDTAQFIEATRGNSALQILAGDLNAQP QDISYKVLLYTSKMLDSCDSDSFRTNECEHNSYTSKQARERNPLGIRIDHIFVRGGDHVN AEIAEYKLPFPERVPGEKFSFSDHEAVMAKLKLFKLEPRSEEPVATIEVNCLVEDGETCS VREVGAGDALTGEDDQSSQHQPEIQCNGSSTSIQSMPAARTAALLEALALCDASLLQLNT DRILYYSAATFLFVLLVLLVEFTAPVGMRTIFLLLKFIVFGVILFCVFMASIWNYMERNG VLQGKKSMEVMLHHAQKYEYFY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CG12034 |
Synonyms | nSMase; CG12034; Putative neutral sphingomyelinase |
UniProt ID | Q9VZS6 |
◆ Recombinant Proteins | ||
ATP5IF1-995H | Recombinant Human ATP5IF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SCO3011-1234S | Recombinant Streptomyces coelicolor A3(2) SCO3011 protein, His-tagged | +Inquiry |
PLXDC1-1712H | Recombinant Human PLXDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BMP2-011H | Active Recombinant Human BMP2 protein | +Inquiry |
GFER-216H | Recombinant Human GFER, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
APOA2-8036H | Native Human ApoLipoprotein APOA2 | +Inquiry |
Lectin-1813P | Active Native Peanut Lectin Protein, Biotinylated | +Inquiry |
IgG-7439M | Native Mouse IgG Fc Protein | +Inquiry |
ACTA1-853R | Native Rabbit ACTA1 Protein | +Inquiry |
SUOX-248G | Active Native Chicken Sulfite Oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
XRN1-1940HCL | Recombinant Human XRN1 cell lysate | +Inquiry |
CLMP-2191MCL | Recombinant Mouse CLMP cell lysate | +Inquiry |
KCNK6-5032HCL | Recombinant Human KCNK6 293 Cell Lysate | +Inquiry |
ATP5I-8598HCL | Recombinant Human ATP5I 293 Cell Lysate | +Inquiry |
ST6GAL2-1703HCL | Recombinant Human ST6GAL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CG12034 Products
Required fields are marked with *
My Review for All CG12034 Products
Required fields are marked with *
0
Inquiry Basket