Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 98A(Gr98A) Protein, His-Tagged
Cat.No. : | RFL5282DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 98a(Gr98a) Protein (Q9VB30) (1-391aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-391) |
Form : | Lyophilized powder |
AA Sequence : | MEQMSGELHAASLLYMRRLMKCLGMLPFGQNLFSKGFCYVLLFVSLGFSSYWRFSFDYEF DYDFLNDRFSSTIDLSNFVALVLGHAIIVLELLWGNCSKDVDRQLQAIHSQIKLQLGTSN STDRVRRYCNWIYGSLIIRWLIFIVVTIYSNRALTINATYSELVFLARFSEFTLYCAVIL FIYQELIVGGSNVLDELYRTRYEMWSIRRLSLQKLAKLQAIHNSLWQAIRCLECYFQLSL ITLLMKFFIDTSALPYWLYLSRVEHTRVAVQHYVATVECIKLLEIVVPCYLCTRCDAMQR KFLSMFYTVTTDRRSSQLNAALRSLNLQLSQEKYKFSAGGMVDINTEMLGKFFFGMISYI VICIQFSINFRAKKMSNEQMSQNITSTSAPI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr98a |
Synonyms | Gr98a; GR98B.4; CG13976; Putative gustatory receptor 98a |
UniProt ID | Q9VB30 |
◆ Native Proteins | ||
F10-26946TH | Native Human F10 | +Inquiry |
F13-53H | Active Native Human Coagulation Factor XIII, Alexa Fluor 700 Conjugated | +Inquiry |
Collagen Type I-03R | Native Rat Collagen Type I (Atelocollagen) Protein | +Inquiry |
F5-5300H | Native Human Coagulation Factor V (proaccelerin, labile factor) | +Inquiry |
VZV-04 | Native Varicella Zoster Virus (VZV) Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
ES-E14TG2a-574M | ES-E14TG2a (mouse pluripotent embryonic stem cell) whole cell lysate | +Inquiry |
MMP9-1940RCL | Recombinant Rat MMP9 cell lysate | +Inquiry |
SLC25A34-1766HCL | Recombinant Human SLC25A34 293 Cell Lysate | +Inquiry |
GTF3C6-5688HCL | Recombinant Human GTF3C6 293 Cell Lysate | +Inquiry |
Lung-325M | Mouse Lung Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Gr98a Products
Required fields are marked with *
My Review for All Gr98a Products
Required fields are marked with *
0
Inquiry Basket