Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 94A(Gr94A) Protein, His-Tagged
Cat.No. : | RFL15333DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 94a(Gr94a) Protein (Q8IMZ5) (1-404aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-404) |
Form : | Lyophilized powder |
AA Sequence : | MDFTSDYAHRRMVKFLTIILIGFMTVFGLLANRYRAGRRERFRFSKANLAFASLWAIAFS LVYGRQIYKEYQEGQINLKDATTLYSYMNITVAVINYVSQMIISDHVAKVLSKVPFFDTL KEFRLDSRSLYISIVLALVKTVAFPLTIEVAFILQQRRQHPEMSLIWTLYRLFPLIISNF LNNCYFGAMVVVKEILYALNRRLEAQLQEVNLLQRKDQLKLYTKYYRMQRFCALADELDQ LAYRYRLIYVHSGKYLTPMSLSMILSLICHLLGITVGFYSLYYAIADTLIMGKPYDGLGS LINLVFLSISLAEITLLTHLCNHLLVATRRSAVILQEMNLQHADSRYRQAVHGFTLLVTV TKYQIKPLGLYELDMRLISNVFSAVASFLLILVQADLSQRFKMQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr94a |
Synonyms | Gr94a; GR94E.1; CG31280; Putative gustatory receptor 94a |
UniProt ID | Q8IMZ5 |
◆ Native Proteins | ||
Lectin-1790G | Active Native Griffonia Simplicifolia Lectin II Protein | +Inquiry |
APOA1-256H | Native Human APOA1 protein | +Inquiry |
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
CAPN1-27397TH | Active Native Human Calpain-1 | +Inquiry |
HYAL1-39B | Active Native Bovine Hyaluronidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIP1R-789HCL | Recombinant Human HIP1R cell lysate | +Inquiry |
AMN1-8879HCL | Recombinant Human AMN1 293 Cell Lysate | +Inquiry |
CDC25C-7664HCL | Recombinant Human CDC25C 293 Cell Lysate | +Inquiry |
PVRL4-2657HCL | Recombinant Human PVRL4 293 Cell Lysate | +Inquiry |
CCDC47-1352HCL | Recombinant Human CCDC47 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr94a Products
Required fields are marked with *
My Review for All Gr94a Products
Required fields are marked with *
0
Inquiry Basket