Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 92A(Gr92A) Protein, His-Tagged
Cat.No. : | RFL30182DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 92a(Gr92a) Protein (Q8IN58) (1-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-386) |
Form : | Lyophilized powder |
AA Sequence : | MFEFLHQMSAPKLSTSILRYIFRYAQFIGVIFFCLHTRKDDKTVFIRNWLKWLNVTHRII TFTRFFWVYIASISIKTNRVLQVLHGMRLVLSIPNVAVILCYHIFRGPEIIDLINQFLRL FRQVSDLFKTKTPGFGGRRELILILLNLISFAHEQTYLWFTIRKGFSWRFLIDWWCDFYL VSATNIFIHINSIGYLSLGVLYSELNKYVYTNLRIQLQKLNTSGSKQKIRRVQNRLEKCI SLYREIYHTSIMFHKLFVPLLFLALIYKVLLIALIGFNVAVEFYLNSFIFWILLGKHVLD LFLVTVSVEGAVNQFLNIGMQFGNVGDLSKFQTTLDTLFLHLRLGHFRVSILGLFDVTQM QYLQFLSALLSGLAFIAQYRMQVGNG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr92a |
Synonyms | Gr92a; CG31208; Putative gustatory receptor 92a |
UniProt ID | Q8IN58 |
◆ Native Proteins | ||
Mucin-232P | Native Porcine Mucin | +Inquiry |
Troponin T-12H | Native Human cardiac Troponin T protein | +Inquiry |
IgG-148H | Native Human IgG Fab fragment | +Inquiry |
ALB-311H | Native Human Albumin, Texas Red Label | +Inquiry |
Lectin-1739H | Active Native Hippeastrum Hybrid (Amaryllis) Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
INTS4-864HCL | Recombinant Human INTS4 cell lysate | +Inquiry |
TSEN2-1843HCL | Recombinant Human TSEN2 cell lysate | +Inquiry |
IL26-5230HCL | Recombinant Human IL26 293 Cell Lysate | +Inquiry |
CHML-350HCL | Recombinant Human CHML cell lysate | +Inquiry |
USP7-672HCL | Recombinant Human USP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr92a Products
Required fields are marked with *
My Review for All Gr92a Products
Required fields are marked with *
0
Inquiry Basket