Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 89A(Gr89A) Protein, His-Tagged
Cat.No. : | RFL29506DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 89a(Gr89a) Protein (Q9VEU0) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MLRFPHVCGLCLLLKYWQILALAPFRTSEPMVARCQRWMTLIAVFRWLLLTSMAPFVLWK SAAMYEATNVRHSMVFKTIALATMTGDVCISLALLGNHLWNRRELANLVNDLARLHRRRR LSWWSTLFLWLKLLLSLYDLLCSVPFLKGAGGRLPWSQLVAYGVQLYFQHVASVYGNGIF GGILLMLECYNQLEREEPTNLARLLQKEYSWLRLIQRFVKLFQLGIFLLVLGSFVNIMVN IYAFMSYYVSLHGVPLTISNNCLVLAIQLYAVILAAHLCQVRSAKLRKKCLQLEYVPEGL TQEQAMASTPFPVLTPTGNVKFRILGVFILDNSFWLFLVSYAMNFIVVILQTSFEHINHG EI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr89a |
Synonyms | Gr89a; CG14901; Putative gustatory receptor 89a |
UniProt ID | Q9VEU0 |
◆ Recombinant Proteins | ||
PDCD1LG2-172H | Active Recombinant Human PDCD1LG2, Fc-tagged | +Inquiry |
CKAP4-2484M | Recombinant Mouse CKAP4 Protein (109-575 aa), His-Myc-tagged | +Inquiry |
ALB-017A | Recommended Human ALB | +Inquiry |
FXYD7-6109M | Recombinant Mouse FXYD7 Protein | +Inquiry |
UBE2L6-0231H | Recombinant Human UBE2L6 Protein (M2-S153), His/Strep tagged | +Inquiry |
◆ Native Proteins | ||
GCA-2H | Native Human Gastrointestinal Cancer Antigen | +Inquiry |
Testosterone-01H | Native Human Testosterone | +Inquiry |
CTRC-27191TH | Native Human CTRC | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
F10-28S | Native Snake Russells Viper Venom Factor X Activator | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLEKHF1-3112HCL | Recombinant Human PLEKHF1 293 Cell Lysate | +Inquiry |
TPD52L3-849HCL | Recombinant Human TPD52L3 293 Cell Lysate | +Inquiry |
PRR15-2814HCL | Recombinant Human PRR15 293 Cell Lysate | +Inquiry |
TBX19-1203HCL | Recombinant Human TBX19 293 Cell Lysate | +Inquiry |
AMY2A-1351HCL | Recombinant Human AMY2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr89a Products
Required fields are marked with *
My Review for All Gr89a Products
Required fields are marked with *
0
Inquiry Basket