Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 59E(Gr59E) Protein, His-Tagged
Cat.No. : | RFL36113DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 59e(Gr59e) Protein (Q9W1N6) (1-399aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-399) |
Form : | Lyophilized powder |
AA Sequence : | MDSSYWENLLLTINRFLGVYPSGRVGVLRWLHTLWSLFLLMYIWTGSIVKCLEFTVEIPT IEKLLYLMEFPGNMATIAILVYYAVLNRPLAHGAELQIERIITGLKGKAKRLVYKRHGQR TLHLMATTLVFHGLCVLVDVVNYDFEFWTTWSSNSVYNLPGLMMSLGVLQYAQPVHFLWL VMDQMRMCLKELKLLQRPPQGSTKLDACYESAFAVLVDAGGGSALMIEEMRYTCNLIEQV HSQFLLRFGLYLVLNLLNSLVSICVELYLIFNFFETPLWEESVLLVYRLLWLAMHGGRIW FILSVNEQILEQKCNLCQLLNELEVCSSRLQRTINRFLLQLQRSIDQPLEACGIVTLDTR SLGGFIGVLMAIVIFLIQIGLGNKSLMGVALNRSNWVYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr59e |
Synonyms | Gr59e; GR59E.2; CG33151; Putative gustatory receptor 59e |
UniProt ID | Q9W1N6 |
◆ Recombinant Proteins | ||
IFNA6-191H | Recombinant Human IFNA6 protein, GST-tagged | +Inquiry |
EML1-5179M | Recombinant Mouse EML1 Protein | +Inquiry |
GYS1-324H | Recombinant Human GYS1 Protein, His-tagged | +Inquiry |
VWA2-6897H | Recombinant Human VWA2 protein, His-tagged | +Inquiry |
RFT1-7544M | Recombinant Mouse RFT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
C3a-08H | Native Human Complement C3 alpha protein | +Inquiry |
CAT-75H | Native Human Catalase | +Inquiry |
Lectin-1831R | Active Native Ricinus Communis Agglutinin I Protein, Biotinylated | +Inquiry |
THBS-260H | Native Human Thrombospondin | +Inquiry |
APCS-8258H | Native Human Serum Amyloid P | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLCC1-7476HCL | Recombinant Human CLCC1 293 Cell Lysate | +Inquiry |
GPATCH1-730HCL | Recombinant Human GPATCH1 cell lysate | +Inquiry |
CMAS-7422HCL | Recombinant Human CMAS 293 Cell Lysate | +Inquiry |
LEFTY1-980HCL | Recombinant Human LEFTY1 cell lysate | +Inquiry |
DVL1-6766HCL | Recombinant Human DVL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr59e Products
Required fields are marked with *
My Review for All Gr59e Products
Required fields are marked with *
0
Inquiry Basket