Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 58A(Gr58A) Protein, His-Tagged
Cat.No. : | RFL11781DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 58a(Gr58a) Protein (P58962) (1-395aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-395) |
Form : | Lyophilized powder |
AA Sequence : | MLLKFMYIYGIGCGLMPAPLKKGQFLLGYKQRWYLIYTACLHGGLLTVLPFTFPHYMYDD SYMSSNPVLKWTFNLTNITRIMAMFSGVLLMWFRRKRILNLGENLILHCLKCKTLDNRSK KYSKLRKRVRNVLFQMLLVANLSILLGALILFRIHSVQRISKTAMIVAHITQFIYVVFMM TGICVILLVLHWQSERLQIALKDLCSFLNHEERNSLTLSENKANRSLGKLAKLFKLFAEN QRLVREVFRTFDLPIALLLLKMFVTNVNLVYHGVQFGNDTIETSSYTRIVGQWVVISHYW SAVLLMNVVDDVTRRSDLKMGDLLREFSHLELVKRDFHLQLELFSDHLRCHPSTYKVCGL FIFNKQTSLAYFFYVLVQVLVLVQFDLKNKVEKRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr58a |
Synonyms | Gr58a; GR58A.1; CG30396; Putative gustatory receptor 58a |
UniProt ID | P58962 |
◆ Recombinant Proteins | ||
CEP44-999R | Recombinant Rat CEP44 Protein, His (Fc)-Avi-tagged | +Inquiry |
bioA-4633E | Recombinant Escherichia coli (strain K12) bioA protein, His&Myc-tagged | +Inquiry |
HRSP12-2570R | Recombinant Rat HRSP12 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD3E & CD3D-2963R | Recombinant Rabbit CD3E & CD3D protein, His &Flag-tagged | +Inquiry |
CDC37-2013HFL | Recombinant Full Length Human CDC37 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
Actin-3084R | Active Native Rabbit Actin Protein | +Inquiry |
Lectin-1845S | Active Native Soybean Agglutinin Protein, Agarose bound | +Inquiry |
AGP-001B | Native Bovine AGP Protein | +Inquiry |
Luciferase-10V | Native Vibrio fischeri Luciferase | +Inquiry |
HBb-49S | Native Sheep Hemoglobin Beta (HBb) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GUCA1A-002HCL | Recombinant Human GUCA1A cell lysate | +Inquiry |
Adrenal-631B | Bovine Cortex Lysate, Total Protein | +Inquiry |
NAB1-3989HCL | Recombinant Human NAB1 293 Cell Lysate | +Inquiry |
COBLL1-7386HCL | Recombinant Human COBLL1 293 Cell Lysate | +Inquiry |
MANF-2212HCL | Recombinant Human MANF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr58a Products
Required fields are marked with *
My Review for All Gr58a Products
Required fields are marked with *
0
Inquiry Basket