Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 47B(Gr47B) Protein, His-Tagged
Cat.No. : | RFL30081DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 47b(Gr47b) Protein (P58961) (1-414aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-414) |
Form : | Lyophilized powder |
AA Sequence : | MQRDDGFVYCYGNLYSLLLYWGLVTIRVRSPDRGGAFSNRWTVCYALFTRSFMVICFMAT VMTKLRDPEMSAAMFGHLSPLVKAIFTWECLSCSVTYIEYCLSLDLQKDRHLKLVARMQE FDRSVLMVFPHVQWNYRRARLKYWYGTVIVGFCFFSFSISLIFDTTRCTCGIPSTLLMAF TYTLLTSSVGLLGFVHIGIMDFIRVRLRLVQQLLHQLYQADDSSEVHERIAYLFEMSKRC SFLLAELNGVFGFAAAAGIFYDFTIMTCFVYVICQKLLEREPWDPEYVYMLLHVAIHTYK VVITSTYGYLLLREKRNCMHLLSQYSRYFSGQDVARRKTEDFQHWRMHNRQAAMVGSTTL LSVSTIYLVYNGMANYVIILVQLLFQQQQIKDHQLTSGKDVDIVGPMGPITHMD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr47b |
Synonyms | Gr47b; CG30030; Putative gustatory receptor 47b |
UniProt ID | P58961 |
◆ Native Proteins | ||
Tnni3-7423M | Native Mouse Tnni3 Protein | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
Lectin-1727W | Native Wheat Germ Lectin, Biotin conjugated | +Inquiry |
Proc-5346M | Native Mouse Protein C | +Inquiry |
ALB-124P | Native Porcine serum albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CGB5-776HCL | Recombinant Human CGB5 cell lysate | +Inquiry |
MIEN1-8239HCL | Recombinant Human C17orf37 293 Cell Lysate | +Inquiry |
ATP6AP2-8591HCL | Recombinant Human ATP6AP2 293 Cell Lysate | +Inquiry |
CBX6-290HCL | Recombinant Human CBX6 cell lysate | +Inquiry |
MFI2-1578MCL | Recombinant Mouse MFI2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr47b Products
Required fields are marked with *
My Review for All Gr47b Products
Required fields are marked with *
0
Inquiry Basket