Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 39A, Isoform C(Gr39A) Protein, His-Tagged
Cat.No. : | RFL22006DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 39a, isoform C(Gr39a) Protein (P58957) (1-381aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-381) |
Form : | Lyophilized powder |
AA Sequence : | MDFQPGELCAYYRLCRYLGIFCIDYNPTKKKFRLRRSVLCYIVHFALQAYLVGCISVMVT YWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQAPHLRIVRQIEFYRRNHLAN VRLLLPKRLLWLIIATNVVYMANFIKTCIFEWLTDASRLFVITSLGFPLRYLVTSFTMGT YFCMVHIVRLVLDWNQSQINAIIDESADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLV YGFIAWLSWMFASLDVTGVIYLTMVIQTKKSIVLKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFT YMVILVQFKEMENSTKSINKF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr39a |
Synonyms | Gr39a; GR39D.2; CG31622; Gustatory and pheromone receptor 39a, isoform C |
UniProt ID | P58957 |
◆ Recombinant Proteins | ||
EIF2AK1-6216C | Recombinant Chicken EIF2AK1 | +Inquiry |
OTC-6720H | Recombinant Human OTC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDC25C-699H | Recombinant Human Cell Division Cycle 25 Homolog C (S. Pombe) | +Inquiry |
KCND2-4725M | Recombinant Mouse KCND2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINB4-6240H | Recombinant Human SERPINB4 Protein (Ser320-Pro390), N-GST tagged | +Inquiry |
◆ Native Proteins | ||
F10-267B | Active Native Bovine Factor X | +Inquiry |
Arg1-150R | Active Native Rat Arginase | +Inquiry |
A35R-01M | Native Monkeypox virus A35R protein | +Inquiry |
CP-8075R | Native Rat Serum Ceruloplasmin | +Inquiry |
Laminin-32H | Native Human Laminin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C21orf119-8105HCL | Recombinant Human C21orf119 293 Cell Lysate | +Inquiry |
Brain-50M | Mouse Brain Membrane Lysate | +Inquiry |
CPE-2656HCL | Recombinant Human CPE cell lysate | +Inquiry |
C1QTNF5-231HCL | Recombinant Human C1QTNF5 cell lysate | +Inquiry |
PROS1-872HCL | Recombinant Human PROS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr39a Products
Required fields are marked with *
My Review for All Gr39a Products
Required fields are marked with *
0
Inquiry Basket