Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 39A, Isoform A(Gr39A) Protein, His-Tagged
Cat.No. : | RFL23663DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 39a, isoform A(Gr39a) Protein (P58959) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-371) |
Form : | Lyophilized powder |
AA Sequence : | MSKVCRDLRIYLRLLHIMGMMCWHFDSDHCQLVATSGSERYAVVYAGCILVSTTAGFIFA LLHPSRFHIAIYNQTGNFYEAVIFRSTCVVLFLVYVILYAWRHRYRDLVQHILRLNRRCA SSCTNQQFLHNIILYGMLTILCFGNYLHGYTRAGLATLPLALCMLVYIFAFLVLCLLLMF FVSLKQVMTAGLIHYNQQLCQGDLISGLRGRQQILKLCGGELNECFGLLMLPIVALVLLM APSGPFFLISTVLEGKFRPDECLIMLLTSSTWDTPWMIMLVLMLRTNGISEEANKTAKML TKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFTYMVILVQFKE MENSTKSINKF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr39a |
Synonyms | Gr39a; GR39D.2; CG31622; Gustatory and pheromone receptor 39a, isoform A |
UniProt ID | P58959 |
◆ Recombinant Proteins | ||
CHD8-1217H | Recombinant Human CHD8 Protein, GST-Tagged | +Inquiry |
PFAS-1651H | Recombinant Human PFAS Protein, His (Fc)-Avi-tagged | +Inquiry |
PCSK1N-4306R | Recombinant Rat PCSK1N Protein | +Inquiry |
Cd3e-374M | Recombinant Mouse Cd3e protein, Fc-tagged | +Inquiry |
RFL12296MF | Recombinant Full Length Mouse Ceramide Synthase 1(Cers1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
Hb-901M | Native Mouse Hemoglobin Protein | +Inquiry |
IgM-331S | Native Sheep IgM | +Inquiry |
S100AA-258B | Native Bovine S-100αα Protein | +Inquiry |
HbA1c-21R | Native Rhesus monkey Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGA1-5137HCL | Recombinant Human ITGA1 293 Cell Lysate | +Inquiry |
ACLY-509HCL | Recombinant Human ACLY cell lysate | +Inquiry |
S100A9-684HCL | Recombinant Human S100A9 cell lysate | +Inquiry |
MITD1-4307HCL | Recombinant Human MITD1 293 Cell Lysate | +Inquiry |
TNFRSF21-2424MCL | Recombinant Mouse TNFRSF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Gr39a Products
Required fields are marked with *
My Review for All Gr39a Products
Required fields are marked with *
0
Inquiry Basket