Recombinant Full Length Drosophila Melanogaster Putative Ferric-Chelate Reductase 1 Homolog(Cg8399) Protein, His-Tagged
Cat.No. : | RFL9028DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative ferric-chelate reductase 1 homolog(CG8399) Protein (Q8MSU3) (1-647aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-647) |
Form : | Lyophilized powder |
AA Sequence : | MMQALTMRSWLATLVTALLAVAIWPDPGQSLPQGAPETVCDTMLPFHSGGSVLPQNSVSP FSVETSSSTLGQGQTLRVDLTGVPAGLSFGGYMIQARNRNPPHQIIGQFGPARDGTIKLM NCENSVNNSATHSNAGPKQQVILEWQSPVDFLGQVVFNATIAQSYNEFWVGVPSQPVQIV RRDLSAAPPLPTQSPSAPAGTTRAPYVPPSYVAPNNVVAVSSDPIYNGCGQSKNCFGFPD GCVATKSCTSITVVTVRGDVFEFEIQSGKGTNAAYVAVGLSDDAKMGDDLTTECVPENGR VNLYSSLTSASPYSAVRSNVNQNSARLLDASIVDGVIYCRVQRDAVTNVQGRTFDLRNGK YHLLVASGSSLKENSVGYHDIGRLPSAQPINLAEVQDLSGSSRLLIQLHGAFMIAAWIGT TSLGIIFARYFKQTWVGSQSCGTDQWFAWHRLLMVTTWSLTVAAYVLIWVELKQAVWHAH SIIGLITVILCFIQPIGALFRPGPNDKKRPYFNWGHWLGGNLAHILGIVTIFFSVKLPKA ELPEWMDWILVSFVVVHVLVHLIFSIGGMASERHLSQRANTFQMGDMSHHQQHAMRNGMS MERKMDAPYAGMRKGLLGVYGVVLILFVTVLILLVVLAPIEQFLGKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CG8399 |
Synonyms | CG8399; Putative ferric-chelate reductase 1 homolog; DmSDR2 |
UniProt ID | Q8MSU3 |
◆ Recombinant Proteins | ||
SAOUHSC-01807-3837S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01807 protein, His-tagged | +Inquiry |
A14L-28M | Recombinant Monkeypox virus/MPXV A14L Protein, GST/His-tagged | +Inquiry |
GM1679-6686M | Recombinant Mouse GM1679 Protein | +Inquiry |
Ccl2-75M | Active Recombinant Mouse Ccl2 Protein (Gln24-Ala127), N-His tagged, Animal-free, Carrier-free | +Inquiry |
DCAF16-1010R | Recombinant Rhesus Macaque DCAF16 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
TF-132B | Native Bovine Transferrin | +Inquiry |
C2-98H | Active Native Human C2 Protein | +Inquiry |
Prethrombin-2-294M | Native Mouse Prethrombin-2 | +Inquiry |
C3b-09R | Native Rat C3b Protein | +Inquiry |
CGB-1850H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMD1-2757HCL | Recombinant Human PSMD1 293 Cell Lysate | +Inquiry |
RIPPLY2-2331HCL | Recombinant Human RIPPLY2 293 Cell Lysate | +Inquiry |
CRK-7276HCL | Recombinant Human CRK 293 Cell Lysate | +Inquiry |
FUNDC1-6121HCL | Recombinant Human FUNDC1 293 Cell Lysate | +Inquiry |
CORO1B-7344HCL | Recombinant Human CORO1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CG8399 Products
Required fields are marked with *
My Review for All CG8399 Products
Required fields are marked with *
0
Inquiry Basket