Recombinant Full Length Drosophila Melanogaster Putative Fatty Acyl-Coa Reductase Cg8306(Cg8306) Protein, His-Tagged
Cat.No. : | RFL30796DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative fatty acyl-CoA reductase CG8306(CG8306) Protein (Q960W6) (1-516aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-516) |
Form : | Lyophilized powder |
AA Sequence : | MASSPITDFYAGRNVFITGATGFVGVTIVEKLLRDVPNVGTLYLLMRAKKGKSVQERLEE LKKNSVFDKFKELQLQSRLSKIVPIEGDVGLEHLGISPKDRQTLIDNVNVVFHSAATLDF FQSLKETTNINLRGTRRVVELCQQIKNLDALVHVSSAYVNAYLTKVEEKLYPAPEDPEKI IQLSETLNDDALKELEPKLLKDHPNTYTFTKHLAEHEVANVASKFPCGIVRPSMITAAWK EPIPGWTISKNGPQGFFMGASKGVLRRLPLDPSIIMDYIPIDVVVNGIITTGYYVNSLQA KNGGRPADLQIFHLTSSTYKPFRFELMTDKINSYLHDYPLNSAVWYPNLRLVKSLWVFRL SAILFHFIPAIILDLVTKIGGGRPILVRLHKNVWNSLNTLEKFIFTEWHFDSKRLLALSK TLNIVDKKKFFIDIGELAWDEYFSNTILGVRQYLSKEPIKNLEKARRKDKILLGLHVALQ LSFWYGVFKLIVCLTGISTAKAALVLPVLYYLFGLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CG8306 |
Synonyms | CG8306; Putative fatty acyl-CoA reductase CG8306 |
UniProt ID | Q960W6 |
◆ Recombinant Proteins | ||
SAP080A-048-4198S | Recombinant Staphylococcus aureus (strain: CDCTN147) SAP080A_048 protein, His-tagged | +Inquiry |
CD80-588H | Recombinant Human CD80 Protein | +Inquiry |
KISS1-28652TH | Recombinant Human KISS1 | +Inquiry |
COPB1-3823H | Recombinant Human COPB1 protein, His-tagged | +Inquiry |
PRDX2-332H | Recombinant Human PRDX2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Complement C4a-52H | Native Human Complement C4a | +Inquiry |
AMY2-5364P | Native Pig Amylase, Alpha 2B (pancreatic) | +Inquiry |
MLC-240H | Native Human Myosin Light Chain | +Inquiry |
Luciferase-10V | Native Vibrio fischeri Luciferase | +Inquiry |
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSS-396HCL | Recombinant Human LSS lysate | +Inquiry |
WNT5A-293HCL | Recombinant Human WNT5A 293 Cell Lysate | +Inquiry |
ZC3H15-206HCL | Recombinant Human ZC3H15 293 Cell Lysate | +Inquiry |
CASK-001HCL | Recombinant Human CASK cell lysate | +Inquiry |
S100A11-2095HCL | Recombinant Human S100A11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CG8306 Products
Required fields are marked with *
My Review for All CG8306 Products
Required fields are marked with *
0
Inquiry Basket