Recombinant Full Length Drosophila Melanogaster Putative Chemosensory Receptor 65A(Gr65A) Protein, His-Tagged
Cat.No. : | RFL17549DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative chemosensory receptor 65a(Gr65a) Protein (Q8IQ72) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-371) |
Form : | Lyophilized powder |
AA Sequence : | MREVNLLNRFTRQFLFLIVLVTQICGVATFVYNSKAQCFRQSGFLRFYSSLVLIFLALFL IVTTSKMFHNLQAVWPYVVGSVIILVVRIHGLLESAEIVELLNQMLRIMRQVNLMARHPN LFRLKHLLLLLLALQNLLRSLNTIVGISNHSAEAYDSFLNSVILLIILAVLLSFLLQITI NICLFVVLIATYSELHHCTRRISNDMDKLRLHSVHESGQFMVLVKQLQGITEKLIRLRQN VFHITVRIIRHFRFHWLCAIIYGLLPFFSLTAKDQNGFNFLIISALNIIFQWTIFAILSR ESRITRSLCTFHLTNYHKETARTIDELLHQEIWERITVTIYGNTLDTKLLFKLLSISAFC AFVNRLEYLHI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CG32395 |
Synonyms | CG32395; Uncharacterized protein CG32395 |
UniProt ID | Q8IQ72 |
◆ Recombinant Proteins | ||
BRIP1-6136Z | Recombinant Zebrafish BRIP1 | +Inquiry |
Spike-367V | Active Recombinant 2019-nCoV Spike RBD(F490L) Protein, His-tagged | +Inquiry |
PCDHA3-3782C | Recombinant Chicken PCDHA3 | +Inquiry |
RFL1291RF | Recombinant Full Length Bufo Marinus Rhodopsin(Rho) Protein, His-Tagged | +Inquiry |
HA-5663I | Recombinant Influenza B virus HA Protein (Met1-Thr547), C-His tagged | +Inquiry |
◆ Native Proteins | ||
Hemoglobin Glutamer-01B | Native Bovine Hemoglobin Glutamer | +Inquiry |
imALB-36H | Native Human Ischemia Modified Albumin (IMA) Protein | +Inquiry |
IGHG1-617H | Native Human Immunoglobulin Heavy Constant Gamma 1 (G1m marker) | +Inquiry |
Lectin-1864W | Active Native Succinylated Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
Neuraminidase-006C | Active Native Clostridium perfringens Neuraminidase, Type VI | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Heart-143H | Human Fetal Heart Membrane Lysate | +Inquiry |
SLC3A2-2015HCL | Recombinant Human SLC3A2 cell lysate | +Inquiry |
C7-1425HCL | Recombinant Human C7 cell lysate | +Inquiry |
INO80E-5201HCL | Recombinant Human INO80E 293 Cell Lysate | +Inquiry |
NELF-3875HCL | Recombinant Human NELF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CG32395 Products
Required fields are marked with *
My Review for All CG32395 Products
Required fields are marked with *
0
Inquiry Basket