Recombinant Full Length Drosophila Melanogaster Probable G-Protein Coupled Receptor Mth-Like 8(Mthl8) Protein, His-Tagged
Cat.No. : | RFL8396DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Probable G-protein coupled receptor Mth-like 8(mthl8) Protein (Q9W0V7) (22-492aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (22-492) |
Form : | Lyophilized powder |
AA Sequence : | FHEETHYPCAFIDTANITGSYGLDGPFVHNWTVIPRHFVAVYDFVIENGIRIPASRHLRA CVCKTKPCVRICCLRGEIYDLEKRQCLVPVAGVSSLPSHSHMEVELGNGSLRLVKLQPRF SIHVETPCEHMKAVTKGSEYVHWTLHENGTISHRGHIFSKHYCFTPLLHGNSTWEWQPLA CAPEKLYFVLGVREWTYAICLLIAILSMFIVLMVYLMCSEMRNSFYGVAIKAYAICMILG YALLAYLTLHNPANLSNAACRILPSLALMNLVLSFYILSFIAFKLYLSFYGVVFTKLMFW LIFTPIVLVAVGWSFFVGFSYYGSRLIFGGDTCWFDPRNWSVMIYFYAPVFVACAISGFF YVLSQIYIRDQPDIETEKSFESIEKNRFKSFWKYFGYTAVVWVVCICSFAFNYYWENRSH LNYAVSFCMAFHGFAALYALIGKNQQIQNFLRRIDNGEDTCENSVPLSSFG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mthl8 |
Synonyms | mthl8; CG32475; Probable G-protein coupled receptor Mth-like 8; Protein methuselah-like 8 |
UniProt ID | Q9W0V7 |
◆ Native Proteins | ||
Collagen-44H | Native Human Collagen I | +Inquiry |
Protein S-90H | Native Human Protein S | +Inquiry |
LH-12P | Native Porcine Luteinizing Hormone Protein | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
Lectin-1741M | Active Native Musa Paradisiaca (Banana) Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PINX1-3177HCL | Recombinant Human PINX1 293 Cell Lysate | +Inquiry |
NRCAM-1220HCL | Recombinant Human NRCAM cell lysate | +Inquiry |
C19orf40-8207HCL | Recombinant Human C19orf40 293 Cell Lysate | +Inquiry |
DENND3-6976HCL | Recombinant Human DENND3 293 Cell Lysate | +Inquiry |
GMPS-5873HCL | Recombinant Human GMPS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mthl8 Products
Required fields are marked with *
My Review for All mthl8 Products
Required fields are marked with *
0
Inquiry Basket