Recombinant Full Length Drosophila Melanogaster Potassium Voltage-Gated Channel Protein Shaker(Sh) Protein, His-Tagged
Cat.No. : | RFL16063DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Potassium voltage-gated channel protein Shaker(Sh) Protein (P08510) (1-655aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-655) |
Form : | Lyophilized powder |
AA Sequence : | MAAVAGLYGLGEDRQHRKKQQQQQQHQKEQLEQKEEQKKIAERKLQLREQQLQRNSLDGY GSLPKLSSQDEEGGAGHGFGGGPQHFEPIPHDHDFCERVVINVSGLRFETQLRTLNQFPD TLLGDPARRLRYFDPLRNEYFFDRSRPSFDAILYYYQSGGRLRRPVNVPLDVFSEEIKFY ELGDQAINKFREDEGFIKEEERPLPDNEKQRKVWLLFEYPESSQAARVVAIISVFVILLS IVIFCLETLPEFKHYKVFNTTTNGTKIEEDEVPDITDPFFLIETLCIIWFTFELTVRFLA CPNKLNFCRDVMNVIDIIAIIPYFITLATVVAEEEDTLNLPKAPVSPQDKSSNQAMSLAI LRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAG SENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSN FNYFYHRETDQEEMQSQNFNHVTSCPYLPGTLGQHMKKSSLSESSSDMMDLDDGVESTPG LTETHPGRSAVAPFLGAQQQQQQPVASSLSMSIDKQLQHPLQQLTQTQLYQQQQQQQQQQ QNGFKQQQQQTQQQLQQQQSHTINASAAAATSGSGSSGLTMRHNNALAVSIETDV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sh |
Synonyms | Sh; mns; CG12348; Potassium voltage-gated channel protein Shaker; Protein minisleep |
UniProt ID | P08510 |
◆ Recombinant Proteins | ||
RFL7952EF | Recombinant Full Length Escherichia Coli O17:K52:H18 Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
Vtcn1-825M | Recombinant Mouse Vtcn1 Protein, Fc-tagged | +Inquiry |
EPHA1-362H | Recombinant Human EPHA1 Protein, DDK-tagged | +Inquiry |
NI36-RS04520-0972S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS04520 protein, His-tagged | +Inquiry |
CHCHD4-1022R | Recombinant Rat CHCHD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CGB-1856H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
GPDH-119R | Active Native Rabbit Glycerol-3-phosphate Dehydrogenase | +Inquiry |
LYPL-29 | Active Native Lysophospholipase | +Inquiry |
C8-57H | Native Human Complement C8 | +Inquiry |
ALB-116R | Native Rabbit Serum Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLFML1-3580HCL | Recombinant Human OLFML1 293 Cell Lysate | +Inquiry |
DUSP7-516HCL | Recombinant Human DUSP7 cell lysate | +Inquiry |
ARID5A-121HCL | Recombinant Human ARID5A cell lysate | +Inquiry |
LIPG-4724HCL | Recombinant Human LIPG 293 Cell Lysate | +Inquiry |
FAM125A-6438HCL | Recombinant Human FAM125A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Sh Products
Required fields are marked with *
My Review for All Sh Products
Required fields are marked with *
0
Inquiry Basket