Recombinant Full Length Drosophila Melanogaster Phosphatidate Cytidylyltransferase, Photoreceptor-Specific(Cdsa) Protein, His-Tagged
Cat.No. : | RFL32995DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Phosphatidate cytidylyltransferase, photoreceptor-specific(CdsA) Protein (P56079) (1-447aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-447) |
Form : | Lyophilized powder |
AA Sequence : | MAEVRRRKGEDEPLEDTAISGSDAANKRNSAADSSDHVDSEEEKIPEEKFVDELAKNLPQ GTDKTPEILDSALKDLPDRWKNWVIRGIFTWIMICGFALIIYGGPLALMITTLLVQVKCF QEIISIGYQVYRIHGLPWFRSLSWYFLLTSNYFFYGENLVDYFGVVINRVEYLKFLVTYH RFLSFALYIIGFVWFVLSLVKKYYIKQFSLFAWTHVSLLIVVTQSYLIIQNIFEGLIWFI VPVSMIVCNDVMAYVFGFFFGRTPLIKLSPKKTWEGFIGGGFATVLFGILFSYVLCNYQY FICPIQYSEEQGRMTMSCVPSYLFTPQEYSLKLFGIGKTLNLYPFIWHSISLSLFSSIIG PFGGFFASGFKRAFKIKDFGDMIPGHGGIMDRFDCQFLMATFVNVYISSFIRTPSPAKLL TQIYNLKPDQQYQIYQSLKDNLGDMLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CdsA |
Synonyms | Cds; CdsA; CG7962; Phosphatidate cytidylyltransferase, photoreceptor-specific; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase |
UniProt ID | P56079 |
◆ Recombinant Proteins | ||
GNPDA2-1733R | Recombinant Rhesus Macaque GNPDA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PKN1-4482R | Recombinant Rat PKN1 Protein | +Inquiry |
CELA3B-14HFL | Recombinant Full Length Human CELA3B Protein, N-GST/C-His-tagged | +Inquiry |
LGMN-5017H | Recombinant Human LGMN Protein (Pro19-His432), N-His tagged | +Inquiry |
TMUB2-5848R | Recombinant Rat TMUB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Thrombin-28B | Active Native Bovine alpha-Thrombin-DFP | +Inquiry |
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
C6-101H | Native Human C6 Protein | +Inquiry |
IgM-235H | Native Human Immunoglobulin M (IgM) | +Inquiry |
H1N12099-209I | Native H1N1 (A/New Caledonia/20/99) H1N12099 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCSAML-8179HCL | Recombinant Human C1orf150 293 Cell Lysate | +Inquiry |
IGKV1-5-845HCL | Recombinant Human IGKV1-5 cell lysate | +Inquiry |
GATS-690HCL | Recombinant Human GATS cell lysate | +Inquiry |
DNAJC5G-6871HCL | Recombinant Human DNAJC5G 293 Cell Lysate | +Inquiry |
PEMT-3299HCL | Recombinant Human PEMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CdsA Products
Required fields are marked with *
My Review for All CdsA Products
Required fields are marked with *
0
Inquiry Basket