Recombinant Full Length Drosophila Melanogaster Odorant Receptor 59A(Or59A) Protein, His-Tagged
Cat.No. : | RFL9847DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Odorant receptor 59a(Or59a) Protein (P81923) (1-397aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-397) |
Form : | Lyophilized powder |
AA Sequence : | MAEVRVDSLEFFKSHWTAWRYLGVAHFRVENWKNLYVFYSIVSNLLVTLCYPVHLGISLF RNRTITEDILNLTTFATCTACSVKCLLYAYNIKDVLEMERLLRLLDERVVGPEQRSIYGQ VRVQLRNVLYVFIGIYMPCALFAELSFLFKEERGLMYPAWFPFDWLHSTRNYYIANAYQI VGISFQLLQNYVSDCFPAVVLCLISSHIKMLYNRFEEVGLDPARDAEKDLEACITDHKHI LEWAGGSLVRVLFTFQLFSRLFRRIEAFISLPMLIQFTVTALNVCIGLAALVFFVSEPMA RMYFIFYSLAMPLQIFPSCFFGTDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQSL KKSTAVAGGMMRIHLDTFFSTLKGAYSLFTIIIRMRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or59a |
Synonyms | Or59a; AN6; dor46; DOR59D.1; Or59D.1; CG9820; Odorant receptor 59a |
UniProt ID | P81923 |
◆ Recombinant Proteins | ||
SENP8-4644H | Recombinant Human SENP8 protein, His-SUMO-tagged | +Inquiry |
GSTP1-580C | Recombinant Cynomolgus GSTP1 Protein, His-tagged | +Inquiry |
RFL17657AF | Recombinant Full Length Anopheles Albimanus Protein White(W) Protein, His-Tagged | +Inquiry |
CCL4-10850H | Recombinant Human CCL4, GST-tagged | +Inquiry |
SPPL3-8673M | Recombinant Mouse SPPL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
TF-324H | Native Human Transferrin, Texas Red Label | +Inquiry |
IgG-125G | Native Goat Immunoglobulin G | +Inquiry |
GFAP-18P | Native Porcine GFAP Protein | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
IgG-119S | Native Sheep Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
LPIN2-4667HCL | Recombinant Human LPIN2 293 Cell Lysate | +Inquiry |
FBXL7-273HCL | Recombinant Human FBXL7 lysate | +Inquiry |
SHC4-1861HCL | Recombinant Human SHC4 293 Cell Lysate | +Inquiry |
CSF3R-1803HCL | Recombinant Human CSF3R cell lysate | +Inquiry |
RIPK3-2332HCL | Recombinant Human RIPK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or59a Products
Required fields are marked with *
My Review for All Or59a Products
Required fields are marked with *
0
Inquiry Basket