Recombinant Full Length Drosophila Melanogaster Odorant Receptor 33B(Or33B) Protein, His-Tagged
Cat.No. : | RFL14728DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Odorant receptor 33b(Or33b) Protein (P81915) (1-379aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-379) |
Form : | Lyophilized powder |
AA Sequence : | MDLKPRVIRSEDIYRTYWLYWHLLGLESNFFLNRLLDLVITIFVTIWYPIHLILGLFMER SLGDVCKGLPITAACFFASFKFICFRFKLSEIKEIEILFKELDQRALSREECEFFNQNTR REANFIWKSFIVAYGLSNISAIASVLFGGGHKLLYPAWFPYDVQATELIFWLSVTYQIAG VSLAILQNLANDSYPPMTFCVVAGHVRLLAMRLSRIGQGPEETIYLTGKQLIESIEDHRK LMKIVELLRSTMNISQLGQFISSGVNISITLVNILFFADNNFAITYYGVYFLSMVLELFP CCYYGTLISVEMNQLTYAIYSSNWMSMNRSYSRILLIFMQLTLAEVQIKAGGMIGIGMNA FFATVRLAYSFFTLAMSLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or33b |
Synonyms | Or33b; AN1; DOR33B.2; dor72; Or33B.2; CG16961; Odorant receptor 33b |
UniProt ID | P81915 |
◆ Recombinant Proteins | ||
ZNF507-10433M | Recombinant Mouse ZNF507 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL4377SF | Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Mitochondrial Carrier Yfr045W (Yfr045W) Protein, His-Tagged | +Inquiry |
CPXM1-838R | Recombinant Rhesus Macaque CPXM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IPO8-4583M | Recombinant Mouse IPO8 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPLX1-27588TH | Recombinant Human CPLX1, His-tagged | +Inquiry |
◆ Native Proteins | ||
PLAT-29690TH | Native Human Human SERPINE1 | +Inquiry |
PPBP-30279TH | Native Human PPBP | +Inquiry |
Lectin-1755C | Active Native Canavalia ensiformis Concanavalin A Protein | +Inquiry |
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
CTRC-27191TH | Native Human CTRC | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX6B1-7329HCL | Recombinant Human COX6B1 293 Cell Lysate | +Inquiry |
TREML2-2237HCL | Recombinant Human TREML2 cell lysate | +Inquiry |
TNFSF12-1204RCL | Recombinant Rat TNFSF12 cell lysate | +Inquiry |
CDK8-7620HCL | Recombinant Human CDK8 293 Cell Lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or33b Products
Required fields are marked with *
My Review for All Or33b Products
Required fields are marked with *
0
Inquiry Basket