Recombinant Full Length Drosophila Melanogaster Neuropeptides Capa Receptor(Capar) Protein, His-Tagged
Cat.No. : | RFL17177DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Neuropeptides capa receptor(capaR) Protein (Q8ITC7) (1-477aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-477) |
Form : | Lyophilized powder |
AA Sequence : | MNSSTDPTFSELNASFTNTPDTLFATSVSSDPSHGFGEEDYACGTFNCSPKEFVAFVLGP QTLPLYKAVLITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVSDLLYLLF GLPTEVFLYWHQYPDLFGMPFCKIRAFISEACTYVSVFTIVAFSMERFLAICHPLHLYAM VGFKRAIRIITALWIVSFISAIPFGLLSDIQYLNYPLDHSRIEESAFCSMSPKIVNEIPV FEVSFCIFFVIPMILIILLYGRMGAKIRSRTNQKLGVQQGTNNRETRNSQMRKKTVIRML AAVVITFFVCWFPFHLQRLIFLYAKNMDNYLDINEALFSIAGFAYYVSCTVNPIVYSVMS RRYRVAFRELLCGKAVGAYYNSGFARDHSSFRESSAYDRVHSVHVRASQHPNKFETDSSS ANRVLIKKTYSLPLPKNADSTVLSTTDIVIVLENSHTVCEEPKVENDIWIENEETCI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CapaR |
Synonyms | CapaR; CG14575; Neuropeptides capa receptor; Cap2b receptor; Capability receptor |
UniProt ID | Q8ITC7 |
◆ Recombinant Proteins | ||
RFL36258SF | Recombinant Full Length Shewanella Sp. Protease Htpx(Htpx) Protein, His-Tagged | +Inquiry |
STK17B-5791R | Recombinant Rat STK17B Protein | +Inquiry |
RGN-14128M | Recombinant Mouse RGN Protein | +Inquiry |
Scg2-8141R | Recombinant Rat Scg2 protein, His & GST-tagged | +Inquiry |
RFL26241MF | Recombinant Full Length Mouse Adenosine Receptor A2B(Adora2B) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Thrombin-23H | Active Native Human alpha-Thrombin | +Inquiry |
HP-26196TH | Native Human HP | +Inquiry |
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
C3-01R | Native Rabbit C3 Protein | +Inquiry |
IgM-344D | Native Donkey IgM | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL23-7727HCL | Recombinant Human CCL23 293 Cell Lysate | +Inquiry |
FBXO28-6301HCL | Recombinant Human FBXO28 293 Cell Lysate | +Inquiry |
TMEM214-685HCL | Recombinant Human TMEM214 lysate | +Inquiry |
SYTL3-1298HCL | Recombinant Human SYTL3 293 Cell Lysate | +Inquiry |
TEKT2-1151HCL | Recombinant Human TEKT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CapaR Products
Required fields are marked with *
My Review for All CapaR Products
Required fields are marked with *
0
Inquiry Basket