Recombinant Full Length Drosophila Melanogaster Gustatory Receptor 5A For Trehalose(Gr5A) Protein, His-Tagged
Cat.No. : | RFL5516DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Gustatory receptor 5a for trehalose(Gr5a) Protein (Q9W497) (1-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-444) |
Form : | Lyophilized powder |
AA Sequence : | MRQLKGRNRCNRAVRHLKIQGKMWLKNLKSGLEQIRESQVRGTRKNFLHDGSFHEAVAPV LAVAQCFCLMPVCGISAPTYRGLSFNRRSWRFWYSSLYLCSTSVDLAFSIRRVAHSVLDV RSVEPIVFHVSILIASWQFLNLAQLWPGLMRHWAAVERRLPGYTCCLQRARPARRLKLVA FVLLVVSLMEHLLSIISVVYYDFCPRRSDPVESYLLGASAQLFEVFPYSNWLAWLGKIQN VLLTFGWSYMDIFLMMLGMGLSEMLARLNRSLEQQVRQPMPEAYWTWSRTLYRSIVELIR EVDDAVSGIMLISFGSNLYFICLQLLKSINTMPSSAHAVYFYFSLLFLLSRSTAVLLFVS AINDQAREPLRLLRLVPLKGYHPEVFRFAAELASDQVALTGLKFFNVTRKLFLAMAGTVA TYELVLIQFHEDKKTWDCSPFNLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr5a |
Synonyms | Gr5a; GRLU.7; Tre; CG15779; Gustatory receptor 5a for trehalose; Trehalose receptor |
UniProt ID | Q9W497 |
◆ Recombinant Proteins | ||
SMAD5-4899H | Recombinant Human SMAD5 protein, His-tagged | +Inquiry |
UFL1-10884Z | Recombinant Zebrafish UFL1 | +Inquiry |
RFL1049AF | Recombinant Full Length Anoxybacillus Flavithermus Large-Conductance Mechanosensitive Channel(Mscl) Protein, His-Tagged | +Inquiry |
BTG3-2533M | Recombinant Mouse BTG3 Protein | +Inquiry |
BTK-06H | Recombinant Human BTK (R562W) Mutant Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
SUOX-248G | Active Native Chicken Sulfite Oxidase | +Inquiry |
SLC40A1-5335H | Native Human Solute Carrier Family 40 (iron-regulated transporter), Member 1 | +Inquiry |
FGG -48S | Native Sheep Fibrinogen, FITC Labeled | +Inquiry |
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
LAMA-69M | Native Mouse Laminin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC3B-1889HCL | Recombinant Human CLEC3B cell lysate | +Inquiry |
RPL12-2227HCL | Recombinant Human RPL12 293 Cell Lysate | +Inquiry |
Parietal Lobe-375R | Rhesus monkey Parietal Lobe Lysate | +Inquiry |
SDHAF2-2010HCL | Recombinant Human SDHAF2 293 Cell Lysate | +Inquiry |
DECR2-462HCL | Recombinant Human DECR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr5a Products
Required fields are marked with *
My Review for All Gr5a Products
Required fields are marked with *
0
Inquiry Basket