Recombinant Full Length Drosophila Melanogaster Frizzled-3(Fz3) Protein, His-Tagged
Cat.No. : | RFL16528DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Frizzled-3(fz3) Protein (O77438) (20-581aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-581) |
Form : | Lyophilized powder |
AA Sequence : | ANGAGHNGPVASGAGPNGLQCQPIAVSACQGLGYNMTALPNLAGHTNQLEAELQIAKLVP LIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMELWPSFL NCDGLPQPEKHELCMQIPQEVAVPGGSPSGPPTTGSPGVEDHPQTYRFWKSGASPTSDLA GVLCPQNFSGSPFNPEECVPQCQRDAFHTSSQKKTSETLILGLSAVCFVLTLFALVTFWA EPTRFGYPERPVLFLCLCYNLFSVCYLERIVFHNQARMHDVELQGRLMRPGCLLTPPCLA SYITTSYLSLCAASWWLIFALCFYLSSHKKWSSEALEKRSGLFHVLAWVPPLAPPIAALL LEKVRPSELTGMCYAPGFVELPALVLLLLGLYFTLRASRSLLSLQQQLQPTLAHHRFGQI RKRFVLFSLLYFAPTTAGVVAALCERYADSVPSCSTPDDCLSPTPLSAWPALVRIFFQLV GGTLTGLWVWSRKTCESYRNRLGASGTPTSSLMNQSKAAGALPKKHLYTSGKSMLPTGGI TPLYAGISFHNVPVYNPNQSRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fz3 |
Synonyms | fz3; CG16785; Frizzled-3; dFz3 |
UniProt ID | O77438 |
◆ Recombinant Proteins | ||
NPPA-6641HF | Recombinant Full Length Human NPPA Protein, GST-tagged | +Inquiry |
Il23A-602HF | Recombinant Full Length Human Il23A Protein, GST-tagged | +Inquiry |
TLR5-2075H | Recombinant Human TLR5 protein, His & S-tagged | +Inquiry |
HLA-DQA1-5284H | Recombinant Human HLA-DQA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NECTIN1-223H | Recombinant Human NECTIN1 protein | +Inquiry |
◆ Native Proteins | ||
a-acid glycoprotein-003H | Native Human a-acid glycoprotein Protein | +Inquiry |
GPT-189P | Active Native Porcine Glutamate Pyruvate Transaminase (GPT), Alanine Transaminase (ALT) | +Inquiry |
FGA-6H | Native Human Fibrinogen Protein, Alexa Fluor 488 labeled | +Inquiry |
Hemocyanin-031H | Native Helix pomatia Hemocyanin Protein | +Inquiry |
ATF-180M | Native Mouse Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKMY1-78HCL | Recombinant Human ANKMY1 cell lysate | +Inquiry |
HPX-2279MCL | Recombinant Mouse HPX cell lysate | +Inquiry |
FGD2-6254HCL | Recombinant Human FGD2 293 Cell Lysate | +Inquiry |
PRRG4-2808HCL | Recombinant Human PRRG4 293 Cell Lysate | +Inquiry |
FOPNL-8248HCL | Recombinant Human C16orf63 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fz3 Products
Required fields are marked with *
My Review for All fz3 Products
Required fields are marked with *
0
Inquiry Basket