Recombinant Full Length Drosophila Melanogaster Calcium-Binding Mitochondrial Carrier Protein Aralar1(Aralar1) Protein, His-Tagged
Cat.No. : | RFL4233DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Calcium-binding mitochondrial carrier protein Aralar1(aralar1) Protein (Q9VA73) (1-695aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-695) |
Form : | Lyophilized powder |
AA Sequence : | MPMHIPFPFNWIPTLPVARCQESPSLLKRAGTEKLREVFLKYASIQKNGEHYMTSEDFVR KFLGLFSESAFNDESVRLLANIADTSKDGLISFSEFQAFEGLLCTPDALYRTAFQLFDRK GNGTVSYADFADVVQKTELHSKIPFSLDGPFIKRYFGDKKQRLINYAEFTQLLHDFHEEH AMEAFRSKDPAGTGFISPLDFQDIIVNVKRHLLTPGVRDNLVSVTEGHKVSFPYFIAFTS LLNNMELIKQVYLHATEGSRTDMITKDQILLAAQTMSQITPLEIDILFHLAGAVHQAGRI DYSDLSNIAPEHYTKHMTHRLAEIKAVESPADRSAFIQVLESSYRFTLGSFAGAVGATVV YPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAI KLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGEIASGSK IRAWSVVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDGYNHPLTLLAAG AIAGVPAASLVTPADVIKTRLQVVARSGQTTYTGVWDATKKIMAEEGPRAFWKGTAARVF RSSPQFGVTLVTYELLQRLFYVDFGGTQPKGSEAHKITTPLEQAAASVTTENVDHIGGYR AAVPLLAGVESKFGLYLPRFGRGVTAASPSTATGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aralar1 |
Synonyms | aralar1; CG2139; Calcium-binding mitochondrial carrier protein Aralar1 |
UniProt ID | Q9VA73 |
◆ Recombinant Proteins | ||
YWHABB-12361Z | Recombinant Zebrafish YWHABB | +Inquiry |
FCGRT-5125C | Recombinant Cynomolgus monkey FCGRT protein, Flag-Myc-tagged | +Inquiry |
RFL19385SF | Recombinant Full Length Southern Cowpea Mosaic Virus Polyprotein P2A(Orf2A) Protein, His-Tagged | +Inquiry |
COL10A1-348B | Recombinant Bovine COL10A1 Protein, His-tagged | +Inquiry |
SUK-0004P2-4256S | Recombinant Staphylococcus aureus (strain: 18811) SUK_0004P2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Spinalcord-C57M | Native Mouse C57 Spinal cord protein | +Inquiry |
FN1-701H | Native Human Fibronectin 1 | +Inquiry |
LRP1-87H | Native Human Lipoproteins | +Inquiry |
HB-44R | Native Rabbit Hemoglobin (HB) Protein | +Inquiry |
FSHB-P051H | Native Human Follicle Stimulating Hormone therapeutic protein(Urofollitropin) | +Inquiry |
◆ Cell & Tissue Lysates | ||
MB21D1-7994HCL | Recombinant Human C6orf150 293 Cell Lysate | +Inquiry |
TPX2-829HCL | Recombinant Human TPX2 293 Cell Lysate | +Inquiry |
GSS-5720HCL | Recombinant Human GSS 293 Cell Lysate | +Inquiry |
FAM186B-6399HCL | Recombinant Human FAM186B 293 Cell Lysate | +Inquiry |
GIMAP5-5937HCL | Recombinant Human GIMAP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All aralar1 Products
Required fields are marked with *
My Review for All aralar1 Products
Required fields are marked with *
0
Inquiry Basket