Recombinant Full Length Drosophila Melanogaster Alkaline Phosphatase 4(Aph-4) Protein, His-Tagged
Cat.No. : | RFL20299DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Alkaline phosphatase 4(Aph-4) Protein (Q24238) (21-570aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (21-570) |
Form : | Lyophilized powder |
AA Sequence : | GVTTQPPPLIRTLSAGGDIGPQFDVGKTKEPEDAEFWHNVGLRQLEKTIKQAQRVKEDSY QKKARNIIIFIGDGMGISTISAGRIYKGQYLKHGYGEEETLVFDDFPNTGMAKTYNVDKQ VPDSAGTATAIFSGSKTHYGAIGMDATRSKKNGQQGRVQSVMEWAQKEGKRTGVVTTTRI THATPAATYAHIYDRDWECDTEVPAESVGFHVDIARQLVENAPGNRFNVILGGGMSPMGI LNASEVKTTIFEGPTETICTRGDNRNLPAEWLAHHANDTVPPALVHNRKDLLNVNVKKVD HLMGLFRNNHITYSIAREAGEPSLQEMTETALGILERGDESNGFVLLVEGGRIDQGHHMN YARAALHELYEFDLAIQAAVNNTDPDETLILVTADHSHAVTFNGYALRGADILGTANSHE KNDPMFYETISYANGPGYWDHLANDSRPQNSSNMWMPLKHFTAEERAAPTYRHLATVPRK DETHGGEDVAVFAYGPGSSLIRGVFEQNYLAYVMSYAGCLGPAKDFDDSCEDHKDGQKDR PLDKPNPKRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Aph4 |
Synonyms | Alp4; aph-4; CG1462; Alkaline phosphatase 4 |
UniProt ID | Q24238 |
◆ Native Proteins | ||
Glycogen-006B | Native Bovine or Rabbit Glycogen | +Inquiry |
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
VTN-385P | Native Pig Vitronectin | +Inquiry |
Lectin-1802L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 488 Labeled | +Inquiry |
LDL-12H | Native Human LDL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPYL4-699HCL | Recombinant Human TSPYL4 293 Cell Lysate | +Inquiry |
FGFR4-1907HCL | Recombinant Human FGFR4 cell lysate | +Inquiry |
TSPAN7-863HCL | Recombinant Human TSPAN7 cell lysate | +Inquiry |
DAO-216HCL | Recombinant Human DAO lysate | +Inquiry |
KRTAP13-4-4850HCL | Recombinant Human KRTAP13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Aph4 Products
Required fields are marked with *
My Review for All Aph4 Products
Required fields are marked with *
0
Inquiry Basket