Recombinant Full Length Dopamine Receptor 4(Dop-4) Protein, His-Tagged
Cat.No. : | RFL26272CF |
Product Overview : | Recombinant Full Length Dopamine receptor 4(dop-4) Protein (Q18775) (1-517aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-517) |
Form : | Lyophilized powder |
AA Sequence : | MLAYGSDPNAEDLYITMTPSVSTENDTTVWATEEPAAIVWRHPLLAIALFSICLLTVAGN CLVVIAVCTKKYLRNPTGYLIISLAIADLIVGVIVMPMNSLFEIANHTWLFGLMMCDVFH AMDILASTASIWNLCVISLDRYMAGQDPIGYRDKVSKRRILMAILSVWVLSAILSFPGII WWRTSSPHLYEDQSQCLFTDSKMYVSFSSLVSFYIPLFLILFAYGKVYIIATRHSKGMRM GIKTVSIKKRNGKKSNTETESILSSENEPTLRIHFGRGKQSSSSLRNSRFHARESTRLLL KQVSCKSLNDRGEHNNNNTVRQPLLRGTEGCHSDSISRSSQRNFRGRNVTIGSNCSSTLL QVDQPDRMSLSSNSQMVMTSPLSTRRKLNVREKSRQMMRYVHEQRAARTLSIVVGAFILC WTPFFVFTPLTAFCESCFSNKETIFTFVTWAGHLNSMLNPLIYSRFSRDFRRAFKQILTC QRQQKVKTAFKTPLSLVFTQLISVTQMWEQPPNTSIE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dop-4 |
Synonyms | dop-4; C52B11.3; Dopamine receptor 4 |
UniProt ID | Q18775 |
◆ Recombinant Proteins | ||
PF4-194H | Active Recombinant Human Platelet Factor 4 | +Inquiry |
TRSG-1862S | Recombinant Staphylococcus aureus TRSG protein, His-tagged | +Inquiry |
MRPS35-1039H | Recombinant Human MRPS35, His-tagged | +Inquiry |
RAB3D-3585H | Recombinant Human RAB3D, His-tagged | +Inquiry |
RAD51D-4195C | Recombinant Chicken RAD51D | +Inquiry |
◆ Native Proteins | ||
IgG1-228H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
Factor D-61H | Native Human Factor D | +Inquiry |
S100A7-3195H | Native Human S100A7 protein(Met1-Gln101) | +Inquiry |
Testosterone-01H | Native Human Testosterone | +Inquiry |
Lectin-1800L | Active Native Lycopersicon Esculentum Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A1-819CCL | Recombinant Cynomolgus MS4A1 cell lysate | +Inquiry |
LINC00303-8176HCL | Recombinant Human C1orf157 293 Cell Lysate | +Inquiry |
CD4-947CCL | Recombinant Cynomolgus CD4 cell lysate | +Inquiry |
BACH1-8532HCL | Recombinant Human BACH1 293 Cell Lysate | +Inquiry |
UGGT2-1878HCL | Recombinant Human UGGT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dop-4 Products
Required fields are marked with *
My Review for All dop-4 Products
Required fields are marked with *
0
Inquiry Basket