Recombinant Full Length Dopamine Receptor 3(Dop-3) Protein, His-Tagged
Cat.No. : | RFL12090CF |
Product Overview : | Recombinant Full Length Dopamine receptor 3(dop-3) Protein (Q6RYS9) (1-607aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-607) |
Form : | Lyophilized powder |
AA Sequence : | MLAGQHHVTDIESPLMVVLWRVAAGVFLPLVPTMAVFGNVLVIMSVFRERSLQTVTNMLI VSLAVSDFMVAIGVMSFGVYYEWNDFKWGLGSFFCHVYQALDVACSTASILNLLAISLDR YIAIGHPISYAQYGARGGRAMISITIVWGVSVAVALPLLLGVNPMEENDLQECELANPYF NMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSENDKISSALLGGAQIARQ MGKHFKNRTDQILLEISFQTSSFPTMSESSEDASTISPMINSFNNFLPKKTPYPSTSIPA IPECGSMPNLTIIERPEAEKEKEISIMDLRDTVEMLDDKYSSAILTSFQTSRSFGEELEE ILPFIDGSNSVKHSREQLHTTRSNTSTTRLLDVKPELRSISVPSIQDEKKLSQKSNDLPF SHQNGTHKQKLLPNPGILMKSKSTTLLKTNGYMDTDSLNRNSHKKSLADLLANDEFSFSD SMRVYKNRLFKSLSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLP FFVLHLSNSICLIIDENSACVGFLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILS CGIFKKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dop-3 |
Synonyms | dop-3; T14E8.3; Dopamine receptor 3; Dopamine D2-like receptor dop-3 |
UniProt ID | Q6RYS9 |
◆ Recombinant Proteins | ||
MDK-6105HF | Recombinant Full Length Human MDK Protein, GST-tagged | +Inquiry |
Anxa9-1650M | Recombinant Mouse Anxa9 Protein, Myc/DDK-tagged | +Inquiry |
AYP1020-RS05630-4964S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS05630 protein, His-tagged | +Inquiry |
CCDC109A-2732H | Recombinant Human CCDC109A protein, His-tagged | +Inquiry |
CMPK-12332Z | Recombinant Zebrafish CMPK | +Inquiry |
◆ Native Proteins | ||
LDH-215S | Active Native Porcine Lactate Dehydrogenase | +Inquiry |
HP-192F | Native Feline Haptoglobin | +Inquiry |
PLAT-30946TH | Native Human PLAT | +Inquiry |
Collagen-325H | Native Human Collagen Type I | +Inquiry |
Fva-285B | Active Native Bovine Factor Va | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD34-1408RCL | Recombinant Rat CD34 cell lysate | +Inquiry |
Lung-326H | Human Lung Membrane Tumor Lysate | +Inquiry |
KLHL4-944HCL | Recombinant Human KLHL4 cell lysate | +Inquiry |
RAB2A-2611HCL | Recombinant Human RAB2A 293 Cell Lysate | +Inquiry |
Fetal Umbilical Cord-180H | Human Fetal Umbilical Cord Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All dop-3 Products
Required fields are marked with *
My Review for All dop-3 Products
Required fields are marked with *
0
Inquiry Basket