Recombinant Full Length Dog Probable G-Protein Coupled Receptor 83(Gpr83) Protein, His-Tagged
Cat.No. : | RFL4131CF |
Product Overview : | Recombinant Full Length Dog Probable G-protein coupled receptor 83(GPR83) Protein (Q9TTQ9) (17-422aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (17-422) |
Form : | Lyophilized powder |
AA Sequence : | AERPEGRADEPGLEAALAGPNASHFFWSNYSFSDWQNFVGRRRYGAESQNPTVKALLVVA YSFIIVFSLFGNVLVCHVIFKNQRMRSATSLFIVNLAVADILITLLNTPFTLVRFVNSTW VFGKGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPRISITKGVIYITVIWTMA TFFSLPHAICQKLFTFKYSEDIVRSLCLPDFPEPADLFWKYLDLATFILLYILPLLIISV AYARVAKKLWLCNTIGDVTTEQYLALRRKKKKTIKMLMLVVVLFALCWFPLNCYVLLLSS KVIHTNNALYFAFHWFAMSSTCYNPFIYCWLNENFRIELKALLSMCQRLPKPQEERPPSP VPSFRVAWTEKSNGRRVPPANNLLLSSHLHSGKTDLSSVEPIVAMS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPR83 |
Synonyms | GPR83; GIR; Probable G-protein coupled receptor 83; Glucocorticoid-induced receptor |
UniProt ID | Q9TTQ9 |
◆ Recombinant Proteins | ||
EMC1-1531H | Recombinant Human EMC1 | +Inquiry |
RFL6965MF | Recombinant Full Length Mouse T-Cell Surface Glycoprotein Cd3 Delta Chain(Cd3D) Protein, His-Tagged | +Inquiry |
SPON1-5376R | Recombinant Rat SPON1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAPN9-1221M | Recombinant Mouse CAPN9 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTAGE1-2258HF | Recombinant Full Length Human CTAGE1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Bilirubin-156P | Native Porcine Bilirubin | +Inquiry |
AC-62H | Native Human Activated Protein C | +Inquiry |
C4A-8392H | Native Human C4A | +Inquiry |
GPT-65H | Active Native Human Glutamate Pyruvate Transaminase (GPT) | +Inquiry |
ORM1-8017R | Native Rat Serum Alpha-1-Acid GlycoProtein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPRCAP-2679HCL | Recombinant Human PTPRCAP 293 Cell Lysate | +Inquiry |
RPS6KB1-001HCL | Recombinant Human RPS6KB1 cell lysate | +Inquiry |
LMO3-4708HCL | Recombinant Human LMO3 293 Cell Lysate | +Inquiry |
TMEM41A-952HCL | Recombinant Human TMEM41A 293 Cell Lysate | +Inquiry |
HK3-550HCL | Recombinant Human HK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR83 Products
Required fields are marked with *
My Review for All GPR83 Products
Required fields are marked with *
0
Inquiry Basket