Recombinant Full Length Dog Olfactory Receptor-Like Protein Olf4 Protein, His-Tagged
Cat.No. : | RFL26461CF |
Product Overview : | Recombinant Full Length Dog Olfactory receptor-like protein OLF4 Protein (Q95157) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-309) |
Form : | Lyophilized powder |
AA Sequence : | MELENDTRIPEFLLLGFSEEPKLQPFLFGLFLSMYLVTILGNLLLILAVSSDSHLHTPMY FFLANLSFVDICFTCTTIPKMLVNIQTQRKVITYESCIIQMYFFELFAGIDNFLLTVMAY DRYMAICYPLHYMVIMNPQLCSLLLLVSWIMSALHSLLQTLMVLRLSFCTHFQIPHFFCE LNQMIQLACSDTFLNNMMLYFAAILLGVAPLVGVLYSYFKIVSSIRGISSAHSKYKAFST CASHLSVVSLFYCTSLGVYLSSAAPQSTHTSSVASVMYTVVTPMLNPFIYSLRNKDIKGA LNVFFRGKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Dog Olfactory receptor-like protein OLF4 |
Synonyms | Olfactory receptor-like protein OLF4 |
UniProt ID | Q95157 |
◆ Recombinant Proteins | ||
Cmklr2-1087R | Recombinant Rat Cmklr2 Full Length Transmembrane protein, His-tagged | +Inquiry |
RFL5125EF | Recombinant Full Length Escherichia Coli Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged | +Inquiry |
PPP2R2D-4296R | Recombinant Rat PPP2R2D Protein, His (Fc)-Avi-tagged | +Inquiry |
APOBEC3DE-192R | Recombinant Rhesus Macaque APOBEC3DE Protein, His (Fc)-Avi-tagged | +Inquiry |
GLIPR2-1688R | Recombinant Rhesus Macaque GLIPR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Fibrinogen-69C | Active Native Canine Fibrinogen | +Inquiry |
LDH3-223H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
Tf-264R | Native Rat Transferrin | +Inquiry |
NEFH-01P | Native Pig NEFH Protein | +Inquiry |
PGI-31 | Active Native Phosphoglucose isomerase | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAF1D-1270HCL | Recombinant Human TAF1D 293 Cell Lysate | +Inquiry |
GPATCH2-731HCL | Recombinant Human GPATCH2 cell lysate | +Inquiry |
EFTUD2-6698HCL | Recombinant Human EFTUD2 293 Cell Lysate | +Inquiry |
CSDA-409HCL | Recombinant Human CSDA cell lysate | +Inquiry |
CABS1-8026HCL | Recombinant Human C4orf35 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Dog Olfactory receptor-like protein OLF4 Products
Required fields are marked with *
My Review for All Dog Olfactory receptor-like protein OLF4 Products
Required fields are marked with *
0
Inquiry Basket