Recombinant Full Length Dog Long-Wave-Sensitive Opsin 1(Opn1Lw) Protein, His-Tagged
Cat.No. : | RFL31080CF |
Product Overview : | Recombinant Full Length Dog Long-wave-sensitive opsin 1(OPN1LW) Protein (O18914) (1-364aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-364) |
Form : | Lyophilized powder |
AA Sequence : | MTQRWGPQRLAGGQPQAGLEESTQASIFTYTNSNATRDPFEGPNYHIAPRWVYHLTSAWM IFVVIASVFTNGLVLVATMRFKKLRHPLNWILVNLAIADLAETIIASTISVVNQIYGYFV LGHPLCVVEGYTVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLAIAGIAFSWIWA AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMTTCCIIPLSVIILCYL QVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAYCLCWGPYTFFACFAAAHPGYAFH PLVAALPAYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVDDSSELSSASRTEASSVSS VSPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OPN1LW |
Synonyms | OPN1LW; RCP; Long-wave-sensitive opsin 1; Red cone photoreceptor pigment; Red-sensitive opsin |
UniProt ID | O18914 |
◆ Recombinant Proteins | ||
BBS7-110H | Recombinant Human BBS7 Protein, GST-tagged | +Inquiry |
RFL27599MF | Recombinant Full Length Mouse Endothelin-1 Receptor(Ednra) Protein, His-Tagged | +Inquiry |
LFNG-2140H | Recombinant Human LFNG Protein (1-250 aa), GST-tagged | +Inquiry |
Gdf15-26M | Recombinant Mouse Gdf15 protein, His-tagged | +Inquiry |
STUB1-2989H | Recombinant Human STUB1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-05T | Native Toxoplasma gondii IgG antigen, RH strain | +Inquiry |
Histone-53C | Native Calf Histone Protein | +Inquiry |
Ferritin-027H | Native Human Ferritin Protein, apo form | +Inquiry |
Collagen Type I-11M | Native Mouse Collagen Type I Protein | +Inquiry |
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
◆ Cell & Tissue Lysates | ||
SP2-1676HCL | Recombinant Human SP2 cell lysate | +Inquiry |
CDC27-7662HCL | Recombinant Human CDC27 293 Cell Lysate | +Inquiry |
BLOC1S1-8444HCL | Recombinant Human BLOC1S1 293 Cell Lysate | +Inquiry |
GIMAP7-5936HCL | Recombinant Human GIMAP7 293 Cell Lysate | +Inquiry |
CENPA-7586HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OPN1LW Products
Required fields are marked with *
My Review for All OPN1LW Products
Required fields are marked with *
0
Inquiry Basket