Recombinant Full Length Dioscorea Elephantipes Apocytochrome F(Peta) Protein, His-Tagged
Cat.No. : | RFL17362DF |
Product Overview : | Recombinant Full Length Dioscorea elephantipes Apocytochrome f(petA) Protein (A6MMM0) (36-320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dioscorea elephantipes (Elephant's foot yam) (Testudinaria elephantipes) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (36-320) |
Form : | Lyophilized powder |
AA Sequence : | YPIFAQQGYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEVKEKMGNLSFQNYRPNKKNIIVIGPAPG QKYSEIVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSAGIVS KIVRKEKGGYEITIIDASDGHQVVDIIPRGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRIQGLLFFLASVILAQIFLVLKKKQFEKVQLYEMNF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petA |
Synonyms | petA; Cytochrome f |
UniProt ID | A6MMM0 |
◆ Recombinant Proteins | ||
MAN1B1-5314M | Recombinant Mouse MAN1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BANF1-5639H | Recombinant Human BANF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDIPT-956R | Recombinant Rat CDIPT Protein, His (Fc)-Avi-tagged | +Inquiry |
OLFCS2-5906Z | Recombinant Zebrafish OLFCS2 | +Inquiry |
SGR-RS13395-686S | Recombinant Streptomyces griseus subsp. griseus NBRC 13350 SGR_RS13395 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IGHA2-615H | Native Human Immunoglobulin Heavy Constant Alpha 2 (A2m marker) | +Inquiry |
Hb-197H | Native Human Hemoglobin | +Inquiry |
ALB-20H | Native Human Serum Albumin Protein | +Inquiry |
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
ALPI-8341C | Native Calf ALPI | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRA2-986HCL | Recombinant Human LILRA2 cell lysate | +Inquiry |
RBM10-2482HCL | Recombinant Human RBM10 293 Cell Lysate | +Inquiry |
ETV3-6523HCL | Recombinant Human ETV3 293 Cell Lysate | +Inquiry |
PLA2G4B-1367HCL | Recombinant Human PLA2G4B cell lysate | +Inquiry |
Pericardium-228C | Cynomolgus monkey Heart: Pericardium Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All petA Products
Required fields are marked with *
My Review for All petA Products
Required fields are marked with *
0
Inquiry Basket