Recombinant Full Length Dictyostelium Discoideum Putative Zdhhc-Type Palmitoyltransferase 8(Ddb_G0280329) Protein, His-Tagged
Cat.No. : | RFL17024DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 8(DDB_G0280329) Protein (Q54VH7) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MIDLFDFVVLSSFIILLPLVTDFLNNTFPNAKIGRLAQEVVGMILVFFIVSLIFAGVSLW YTHFLPFYYTKSLLISFDTLNLLDLLKFINTDNNNNSGSSIFNKITFYFHIFFTIQLVVN LYYYYYQTITADNFLPKISKNKQIQLFASETTTTTTTTTDNINEKKNKLCGLCDQVSDGK WSTINKPKSHHCRICKRCIDSMDHHCPFAANCIGINNHHYFILFIGYTVMALIYACYLSF FPYYHCIVNYKNYVSLSFTNDNDNDNNNNNNFKQLAQSCAKFNKYSFIFLCCCLIVTASF GILLFQTYLIITNSKTVQLLSRLKKSKSFLDWFKWLYQNFKQNASINNIYSLFPNFKFYN LIIPYYKRKINKLNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DDB_G0280329 |
Synonyms | DDB_G0280329; Putative ZDHHC-type palmitoyltransferase 8; Zinc finger DHHC domain-containing protein 8 |
UniProt ID | Q54VH7 |
◆ Recombinant Proteins | ||
Cd274-6957M | Recombinant Mouse CD274 Antigen, His-tagged | +Inquiry |
RFL6651DF | Recombinant Full Length Desulfobacterium Autotrophicum Protein Crcb Homolog(Crcb) Protein, His-Tagged | +Inquiry |
SCG5-7931M | Recombinant Mouse SCG5 Protein, His (Fc)-Avi-tagged | +Inquiry |
JAG1-2375H | Recombinant Human JAG1 Protein (Gln34-Ser1046), C-Fc tagged | +Inquiry |
GNAI2-31364TH | Recombinant Human FPR1 Protein | +Inquiry |
◆ Native Proteins | ||
IBVQ0291-229I | Native Influenza (B/Qingdao/102/91) IBVQ0291 protein | +Inquiry |
HP-200H | Native Human Haptoglobin | +Inquiry |
C1S-550H | Active Native Human C1S Enzyme | +Inquiry |
HGF-232P | Native Porcine HGF | +Inquiry |
LOX1.1-61S | Native soybeans LOX1.1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RUNX1-2111HCL | Recombinant Human RUNX1 293 Cell Lysate | +Inquiry |
INPP1-5200HCL | Recombinant Human INPP1 293 Cell Lysate | +Inquiry |
RBM42-2468HCL | Recombinant Human RBM42 293 Cell Lysate | +Inquiry |
DSC2-1159RCL | Recombinant Rat DSC2 cell lysate | +Inquiry |
293T-2104H | 293T whole cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDB_G0280329 Products
Required fields are marked with *
My Review for All DDB_G0280329 Products
Required fields are marked with *
0
Inquiry Basket