Recombinant Full Length Dictyostelium Discoideum Putative Zdhhc-Type Palmitoyltransferase 1(Ddb_G0276997) Protein, His-Tagged
Cat.No. : | RFL28734DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 1(DDB_G0276997) Protein (Q550R7) (1-434aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-434) |
Form : | Lyophilized powder |
AA Sequence : | MSRPSYASATKTYFHNRLVTGPDRAYFIVAMILMLIPEIPFLIFVCPLFEEWITAAIYPV SIYFWIASYIFLIQTAYTDPGIIPRGIYNDDIFAPDHRQPLFKKITVKDTKQEIKWCETC CLYRPPRANHCGICNNCVERFDHHCPWVGNCIGRRNYQTFLYFLYSLGFLCIWIMGFCVA HICIESARYRDNHPSASSAKVFQEGMNKSHYISDYNYSLWVSRFNSNPYRKSAFANFIEA FCPPRYPSFYKYTLDHEKELTTIPTPNNINGNNNNSINNNNNNNNNNNNNNNNNNNNNNN NNNINNGNSGGTTNNGYTPPISPPQMLQRQSSTIRYSLDNLRTSSNSSLGNFNNLKSSRD LNLSTISEDKPKNLSNSNNNNNTNNKNTSEDNNHSSGSDFGGDEENNEDDFKSDNDKEIN SSSLSLNHELQVNV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DDB_G0276997 |
Synonyms | DDB_G0276997; Putative ZDHHC-type palmitoyltransferase 1; Zinc finger DHHC domain-containing protein 1 |
UniProt ID | Q550R7 |
◆ Recombinant Proteins | ||
Eif4ebp1-1847R | Recombinant Rat Eif4ebp1 protein, His-tagged | +Inquiry |
PRKD2-156HFL | Active Recombinant Full Length Human PRKD2 Protein, N-His-tagged | +Inquiry |
USP10-6469R | Recombinant Rat USP10 Protein | +Inquiry |
RFL32469MF | Recombinant Full Length Myxococcus Xanthus Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
EEPD1-2652M | Recombinant Mouse EEPD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HNMT-1355R | Active Native Rat HNMT Protein | +Inquiry |
Ferritin-027H | Native Human Ferritin Protein, apo form | +Inquiry |
Complement C1q-43H | Native Human Complement C1q | +Inquiry |
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
CEN-27 | Active Native Cholesterol esterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
XAGE3-268HCL | Recombinant Human XAGE3 293 Cell Lysate | +Inquiry |
C1S-8131HCL | Recombinant Human C1S 293 Cell Lysate | +Inquiry |
PPP1R1B-2940HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry |
LSM6-9171HCL | Recombinant Human LSM6 293 Cell Lysate | +Inquiry |
LRRC61-4622HCL | Recombinant Human LRRC61 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDB_G0276997 Products
Required fields are marked with *
My Review for All DDB_G0276997 Products
Required fields are marked with *
0
Inquiry Basket