Recombinant Full Length Dictyostelium Discoideum Protein Sys1 Homolog(Sys1) Protein, His-Tagged
Cat.No. : | RFL26312DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Protein SYS1 homolog(sys1) Protein (Q55E69) (1-232aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-232) |
Form : | Lyophilized powder |
AA Sequence : | MFYKYNAWDPKLIIGQILSIQCLYYILLAGILYLLDSMFSSSLSLEQMFEYQSINTHSQS GRVVMTAFLINSLFGSFCLKYIVERSKKCLDHSATVTFIHFIIVWIVSGFPKTVVWWAIQ LIGMVIMAMIGEYLCMRKELMDIPLQRGKDLDSTPITIPPSPHTSSPIMNPKNNSNGNSG SNNNNNNIFSNSINSSGGSSSSINSIGNSNNPYQPIELEILTHQDKQDEHDD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sys1 |
Synonyms | sys1; DDB_G0269368; Protein SYS1 homolog |
UniProt ID | Q55E69 |
◆ Recombinant Proteins | ||
SYS1-4405R | Recombinant Rhesus Macaque SYS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25199HF | Recombinant Full Length Human Protein Sys1 Homolog(Sys1) Protein, His-Tagged | +Inquiry |
SYS1-4589R | Recombinant Rhesus monkey SYS1 Protein, His-tagged | +Inquiry |
RFL26075NF | Recombinant Full Length Nematostella Vectensis Protein Sys1 Homolog(Sys1) Protein, His-Tagged | +Inquiry |
SYS1-5287C | Recombinant Chicken SYS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYS1-1311HCL | Recombinant Human SYS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sys1 Products
Required fields are marked with *
My Review for All sys1 Products
Required fields are marked with *
0
Inquiry Basket