Recombinant Full Length Dictyostelium Discoideum Probable Mitochondrial 2-Oxoglutarate/Malate Carrier Protein(Ucpc) Protein, His-Tagged
Cat.No. : | RFL15306DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Probable mitochondrial 2-oxoglutarate/malate carrier protein(ucpC) Protein (Q54PY7) (1-318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-318) |
Form : | Lyophilized powder |
AA Sequence : | MSSFNTQNKNVLQTPIPAPTPQSQLKQFVIGGLAGMLSSAFTHPIDSLKVRMQLQGEGTG VGPKRGALKMLVHINQTEGFFTLYKGLSASLLRQATYTTTRFGLYDLIKDIVAKDDKPLP FTQKIMVGMLSGAGGAIVGTPADLTMVRMQADGKLPFNLRRNYKNVFDGIFRISKEEGII SLWKGCSPNLIRAMFMTAGQVSSYDQTKQLMLASGYFHDDIKTHLIASTTAAFVAAVATS PLDVIKTRIMNSPKTVTGELQYKGTFDCLSKTLRAEGFKAFYKGFNPYFMRLGPQTILTF IFVEQLNILWKKSQSYFK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ucpC |
Synonyms | ucpC; slc25a11; DDB_G0284225; Probable mitochondrial 2-oxoglutarate/malate carrier protein; OGCP; Mitochondrial substrate carrier family protein ucpC; Solute carrier family 25 member 11 homolog |
UniProt ID | Q54PY7 |
◆ Recombinant Proteins | ||
CCL13-277H | Active Recombinant Human Chemokine (C-C Motif) Ligand 13, HIgG1 Fc-tagged, mutant | +Inquiry |
CTAK1-4008H | Recombinant Human CTAK1 protein, His-tagged | +Inquiry |
ARPC4-9885H | Recombinant Human ARPC4, GST-tagged | +Inquiry |
MKI67IP-892H | Recombinant Human MKI67IP, GST-tagged | +Inquiry |
HS3ST3A1-2147R | Recombinant Rhesus monkey HS3ST3A1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Cyfra-21-1-01H | Native Human MCF-7 Cell Cyfra-21-1 Antigen | +Inquiry |
IgM-338H | Native Horse IgM | +Inquiry |
Lectin-1762A | Active Native Agaricus bisporus lectin Protein, Biotinylated | +Inquiry |
ALB-20H | Native Human Serum Albumin Protein | +Inquiry |
IgG-016M | Native Mouse Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
Colon-559M | MiniPig Colon Lysate, Total Protein | +Inquiry |
PLAC8L1-3135HCL | Recombinant Human PLAC8L1 293 Cell Lysate | +Inquiry |
SMPDL3B-1654HCL | Recombinant Human SMPDL3B 293 Cell Lysate | +Inquiry |
TIGD1-1077HCL | Recombinant Human TIGD1 293 Cell Lysate | +Inquiry |
SDCBP-2015HCL | Recombinant Human SDCBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ucpC Products
Required fields are marked with *
My Review for All ucpC Products
Required fields are marked with *
0
Inquiry Basket