Recombinant Full Length Dictyostelium Discoideum Myb-Like Protein R(Mybr) Protein, His-Tagged
Cat.No. : | RFL12097DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Myb-like protein R(mybR) Protein (Q54DP7) (1-394aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-394) |
Form : | Lyophilized powder |
AA Sequence : | MDEPSTDKILIGAQIITTVITLFTGVFEFIIAAKSKMKRMKSEQMFSVNQDGLIHIIKSL LPGRNIIFISNAPTSTTDPSFNSQTMKNFLKVIFRLLPFFIGAVFIHLNIIPFHHLIIFT ENGKWYFDSIQEELIPIVKERLKQIMSSQPDVIFACGAVVRDIFYMYLEEGSIEMFEING NLKVDINKFKKIYTTVSDKNISPQSNEILDLFEFDTTKSSYEDVIEEYSKFENDSLGSFE NPDYSGFHLLSKRKWNNKEALIVGIGKSNNKTTVQIKGDLLDKGYFRTELAIDTYFDRNK VLINKMVKNFKSTQEIIKPSPVISGNWSLDEQKALMVEVSTLGNKSEINWFFISKQLFLK GISRNARECQRKHESIQYVGLSGNPKGKFKRTFD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mybR |
Synonyms | mybR; DDB_G0292182; Myb-like protein R |
UniProt ID | Q54DP7 |
◆ Recombinant Proteins | ||
NPY-29655TH | Recombinant Human NPY | +Inquiry |
CLPB-741R | Recombinant Rhesus Macaque CLPB Protein, His (Fc)-Avi-tagged | +Inquiry |
TTBK1-17540M | Recombinant Mouse TTBK1 Protein | +Inquiry |
BNC2-326H | Recombinant Human BNC2 Protein, His-tagged | +Inquiry |
HA-297V | Active Recombinant H1N1 (A/California/07/2009) HA Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1737W | Active Native Wheat Germ Agglutinin Protein, Peroxidase conjugated | +Inquiry |
IGHA1-210H | Native Human Immunoglobulin A1 (IgA1) | +Inquiry |
LDL-394H | Native Human Low Density Lipoprotein, Biotin labeled | +Inquiry |
FABP-174M | Native Cynomolgus Monkey Fatty acid Binding Protein | +Inquiry |
IgG-340G | Native Goat IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHST12-7507HCL | Recombinant Human CHST12 293 Cell Lysate | +Inquiry |
HK1-794HCL | Recombinant Human HK1 cell lysate | +Inquiry |
CDC20-7668HCL | Recombinant Human CDC20 293 Cell Lysate | +Inquiry |
PPT1-001HCL | Recombinant Human PPT1 cell lysate | +Inquiry |
HSDL1-5367HCL | Recombinant Human HSDL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mybR Products
Required fields are marked with *
My Review for All mybR Products
Required fields are marked with *
0
Inquiry Basket