Recombinant Full Length Dictyostelium Discoideum Mitochondrial Substrate Carrier Family Protein X(Mcfx) Protein, His-Tagged
Cat.No. : | RFL19493DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Mitochondrial substrate carrier family protein X(mcfX) Protein (Q86AV5) (1-301aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-301) |
Form : | Lyophilized powder |
AA Sequence : | MVQQQQQQQQIKKNQVKPPLYSNLIAGAIAGVIGSSVVFPLDFVKTRLQQQRVSIDGSKQ YNGIIDCFKKVIKNEGGVRGLYRGLSSNLIGIIPEKALKLAMNDYFRTRFQGDRSYIKLW EEVASGGLAGMCQVVATNPMELVKIRMQVSGLSGKKASLKEVVSELGIKGLYKGTASTLL RDVPFSMIYFSIYGRMKHNLTDQETGEIGLPKILLCGITAGSIAASVSTPFDVIKTRIQV KPGPNDPHYKGIADCFRKTIQSEGPKALFKGVLPRVCIISPLFGITLVVYEIQKSFYAST H |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mcfX |
Synonyms | mcfX; DDB_G0276933; Mitochondrial substrate carrier family protein X |
UniProt ID | Q86AV5 |
◆ Native Proteins | ||
C4-12H | Active Native Human C4 protein | +Inquiry |
IgM-04T | Native Toxoplasma gondii IgM antigen, RH strain | +Inquiry |
PLG-30879TH | Native Human PLG | +Inquiry |
PGI-241H | Native Human Pepsinogen I | +Inquiry |
Streptavidin-24 | Streptavidin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PXMP2-2652HCL | Recombinant Human PXMP2 293 Cell Lysate | +Inquiry |
CD200R1-2226MCL | Recombinant Mouse CD200R1 cell lysate | +Inquiry |
TACO1-1284HCL | Recombinant Human TACO1 293 Cell Lysate | +Inquiry |
C4orf19-8033HCL | Recombinant Human C4orf19 293 Cell Lysate | +Inquiry |
PREP-001MCL | Recombinant Mouse PREP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mcfX Products
Required fields are marked with *
My Review for All mcfX Products
Required fields are marked with *
0
Inquiry Basket