Recombinant Full Length Dictyostelium Discoideum Gamma-Secretase Subunit Aph-1(Aph1) Protein, His-Tagged
Cat.No. : | RFL33414DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Gamma-secretase subunit Aph-1(aph1) Protein (Q55FS3) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MTQVLFYGCLFITFSPILAFFFMVIAKNSQLVILTIGGSFFWLVSILIAAIWWYIIPPMR EHWWFIISFSVLFQEIFRYIFFRLYSYGFNDRPSLNQIKETQHQMALDSMRKRKQAQQQK QQPPTNEIESINNEIIDTTNNNTNNNNNNNNNINDDDNKEITEEEKEKRKIEKQKQREIE INARLETLSARPNHTLSSAAIGVGSGVAYGFIMFGSILWESTGPGTLFSPACPSVNLFML SSIITLFMTLLHVVYNVLAFQGYRSKKYHLVAFVIITHFVTTYLTLLNLPTKTTSCVGSI LPIGIITVFSVGFCIFSLLKSDSITKIH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aph1 |
Synonyms | aph1; DDB_G0267976; Gamma-secretase subunit Aph-1 |
UniProt ID | Q55FS3 |
◆ Recombinant Proteins | ||
MAG-0505M | Recombinant Mouse MAG protein, His-Avi-tagged, Biotinylated | +Inquiry |
GAPVD1-556Z | Recombinant Zebrafish GAPVD1 | +Inquiry |
DDX3Y-1042R | Recombinant Rhesus Macaque DDX3Y Protein, His (Fc)-Avi-tagged | +Inquiry |
PHLPP2-1670H | Recombinant Human PHLPP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MFSD7-4373H | Recombinant Human MFSD7 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
PLG-30879TH | Native Human PLG | +Inquiry |
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
Lectin-1737W | Active Native Wheat Germ Agglutinin Protein, Peroxidase conjugated | +Inquiry |
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
F13-53H | Active Native Human Coagulation Factor XIII, Alexa Fluor 700 Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAX8-3412HCL | Recombinant Human PAX8 293 Cell Lysate | +Inquiry |
CHAD-182HCL | Recombinant Human CHAD lysate | +Inquiry |
Fetal Thymus-174H | Human Fetal Thymus Membrane Lysate | +Inquiry |
BMP7-8429HCL | Recombinant Human BMP7 293 Cell Lysate | +Inquiry |
Spleen-471R | Rhesus monkey Spleen Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All aph1 Products
Required fields are marked with *
My Review for All aph1 Products
Required fields are marked with *
0
Inquiry Basket