Recombinant Full Length Dictyostelium Discoideum Frizzled/Smoothened-Like Sans Crd Protein J(Fscj) Protein, His-Tagged
Cat.No. : | RFL30320DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Frizzled/smoothened-like sans CRD protein J(fscJ) Protein (Q54DP2) (24-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (24-407) |
Form : | Lyophilized powder |
AA Sequence : | QIACPSPFLYRATNDTVGDYDLGYQYINIGKPLPPQLSFLNNCLMPCQSSFFEQDSWNSF NKLVKQMGAVAFTCSAIIMIIYGPLMNRSFFKFDRHTITVFCFALSTFFIGVSDLMFATN DVDMVCPESHRYARQTDKTCATNGVLFQFGWLGSVMWFAFLSIDGFFRASGKKMNKIAFA IVLASIWILNIVLSFAPMGGDQYGAYFVGQVNCWILVKNWQYAFFWAELIVSLAIGFVGI CLTIYSLIRKTSDGNTLKHVTPLILVFLLFCQYLYMIIFYGIINEKKDHYQNILAEQVGC IFNNALAKMKVPGIVYAGECTFNETITFSSQYAFLFFVRLLGIEIFAFYLFSKETLLLIK SSYIATMFGLGDKDAYDVELEETD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fscJ |
Synonyms | fscJ; DDB_G0292102; Frizzled/smoothened-like sans CRD protein J |
UniProt ID | Q54DP2 |
◆ Recombinant Proteins | ||
RFL25725RF | Recombinant Full Length Rhizobium Meliloti Phaf2 Protein(Phaf2) Protein, His-Tagged | +Inquiry |
SEPW2B-9768Z | Recombinant Zebrafish SEPW2B | +Inquiry |
TK1-6460C | Recombinant Chicken TK1 | +Inquiry |
ABHD5-9243H | Recombinant Human ABHD5 protein, GST-tagged | +Inquiry |
SCO1961-429S | Recombinant Streptomyces coelicolor A3(2) SCO1961 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F5-29S | Native Snake Russells Viper Venom Factor V Activator | +Inquiry |
FABP1-509H | Native Human FABP1 | +Inquiry |
Cyfra-21-1-01H | Native Human MCF-7 Cell Cyfra-21-1 Antigen | +Inquiry |
ACPP-29981TH | Native Human ACPP | +Inquiry |
CG-76H | Active Native Human Chorionic Gonadotropin (CG) | +Inquiry |
◆ Cell & Tissue Lysates | ||
VASH1-428HCL | Recombinant Human VASH1 293 Cell Lysate | +Inquiry |
CACNG6-7900HCL | Recombinant Human CACNG6 293 Cell Lysate | +Inquiry |
ATRIP-8567HCL | Recombinant Human ATRIP 293 Cell Lysate | +Inquiry |
CHML-350HCL | Recombinant Human CHML cell lysate | +Inquiry |
GRHPR-5749HCL | Recombinant Human GRHPR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All fscJ Products
Required fields are marked with *
My Review for All fscJ Products
Required fields are marked with *
0
Inquiry Basket